Property Summary

NCBI Gene PubMed Count 62
PubMed Score 58.57
PubTator Score 62.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
astrocytic glioma -2.700 1.3e-02
ependymoma -3.000 1.5e-02
oligodendroglioma -2.400 2.1e-02
glioblastoma multiforme -2.000 1.7e-11
cystic fibrosis -1.119 1.4e-05
atypical teratoid / rhabdoid tumor 2.400 1.2e-02
adrenocortical carcinoma -1.997 6.5e-04
pancreatic ductal adenocarcinoma liver m... -1.828 4.5e-03
non-small cell lung cancer -3.262 8.9e-25
intraductal papillary-mucinous carcinoma... -1.600 4.7e-02
interstitial cystitis -4.300 2.6e-05
lung adenocarcinoma -3.500 8.8e-20
group 4 medulloblastoma -2.300 4.0e-03
pilocytic astrocytoma -2.500 8.0e-05
subependymal giant cell astrocytoma -3.117 1.7e-02
Endometriosis 1.275 3.4e-02
lung carcinoma -3.800 7.4e-24
Pick disease -1.800 2.0e-02
progressive supranuclear palsy -2.100 1.7e-02
ovarian cancer -3.400 2.8e-11

 IMPC Phenotype (1)

 CSPA Cell Line (2)

Gene RIF (43)

PMID Text
26527870 HHIP - candidate gene for Chronic Obstructive Pulmonary Disease identified by Genome-wide association studies.
25416442 HHIP might be a diagnostic or prognostic marker in glioma and help to the detection of these tumors in early stages of disease.
25215859 Shh-mediated degradation of Hhip allows cell autonomous and non-cell autonomous Shh signaling.
25006744 HHIP is located within genes previously associated with chronic obstructive pulmonary disease susceptibility.
24439425 We show that GPC3, an hepatocellular carcinoma biomarker and Hh mediator, regulates human stellate cell viability by regulating Hh signaling.
23994291 our study suggests that the HHIP gene may be involved in COPD susceptibility in Chinese Han population.
23935859 Data indicate that the Shh signaling transduction is facilitated by binding of Shh to its receptor protein, Ptch, and show the complex structure of Shh-Hhip.
23780909 These data suggest that activated Hedgehog signalling contributes to the biology of human fetal rhabdomyomas.
23731023 Genetic variants in HHIP are associated with FEV1 in subjects with chronic obstructive pulmonary disease.
23459001 Identification of potential HHIP targets of gene expression regulation in chronic obstructive pulmonary disease.
23456936 HHIP, HDAC4, NCR3 and RARB polymorphisms may have a role in impaired lung function that begins in early life
23440386 The data demonstrated that loss of expression of HHIP and PTCH is associated with the methylation of gene promoters
22897141 Results suggest involvement of the Hedgehog pathway in CPHD and that both SHH and HHIP are investigated as a second screening in CPHD, after mutations in the classical CPHD genes have been ruled out.
22457212 GDC-0449 treatment is pharmacodynamically effective as evidenced by paracrine Hedgehog signaling inhibition and results in prostate cancer cell proliferation reduction.
22406999 no correlation between hedgehog activity and SHH, Gli1 and Patched1 mRNA levels was observed. other mechanisms aside from transcriptional regulation of these factors are responsible for hedgehog activity in tumor cells derived from GBM.
22301921 Resveratrol inhibits proliferation and induces apoptosis through the hedgehog signaling pathway in pancreatic cancer cells.(
22140090 Low HHIP expression is associated with chronic obstructive pulmonary disease.
21397937 A subset of normal lung function genes, including HHIP, FAM13A, and PTCH1, together predict lung function abnormalities, a measure of severity in white and African American subjects with asthma.
21210262 We found that HIP, PDGFRalpha, SMO and Su(Fu) gene highly expressed in the primary esophageal squamous cell carcinomas
21119205 the GG genotype of the rs 1489759 HHIP single-nucleotide polymorphism (SNP) and the CC genotype of the rs 2202507 GYPA SNP confers a ''protective'' effect on COPD (OR 0.59, p50.006 for HHIP and OR50.65, p50.006 for GYPA) and lung cancer.
20853133 results suggest the possibility of epigenetic regulation of HHIP in medulloblastoma
20846217 Observational study of gene-disease association. (HuGE Navigator)
20800318 Mutation of the hedgehog signaling patwhway play a key role in the development of basal cell carrcinomas.
20656943 The HHIP locus was associated with the systemic components of COPD and with the frequency of COPD exacerbations.
20656943 Observational study of gene-disease association. (HuGE Navigator)
20546612 Observational study of gene-disease association. (HuGE Navigator)
20397748 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20010835 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
19996190 Genetic variation near the Hip gene was significantly associated with risk of COPD, depending on the number of pack-years of smoking.
19996190 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19915594 show in mice and in human cartilage explants that pharmacological or genetic inhibition of Hh signaling reduces the severity of osteoarthritis and that RUNX2 potentially mediates this process by regulating ADAMTS5 expression
19893584 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19561611 Results describe a series of crystal structures for the human Hedgehog-interacting protein ectodomain and Desert hedgehog (DHH) in isolation, as well as HHIP in complex with DHH (HHIP-DHH) and Sonic hedgehog (Shh) (HHIP-Shh), with and without Ca2+.
19561609 Results propose a role for Hedgehog-interacting protein as a structural decoy receptor for vertebrate Hedgehog.
19300482 Genome-wide significant association of the HHIP locus with lung function. The CHRNA 3/5 and the HHIP loci make a significant contribution to the risk of COPD.
19300482 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19266077 Observational study of gene-disease association. (HuGE Navigator)
18559595 The down-regulation of HHIP transcription is due to DNA hypermethylation and/or loss of heterozygoty in hepatocellular carcinoma.
18391952 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
15970691 Aberrant methylation of the Human Hedgehog interacting protein is associated with pancreatic neoplasms
15754313 The different pattern of expression and abnormal localization in the diseased pancreas suggest that the enhanced activation of hedgehog signaling in in pancreatic cancer and pancreatic duct carcinoma.
15294024 These results suggest that reduced expression of HIP, a naturally occurring Hh pathway antagonist, in tumor neo-vasculature may contribute to increased Hh signaling within the tumor and possibly promote angiogenesis.

AA Sequence

MLKMLSFKLLLLAVALGFFEGDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRMMSQLELLSGGEMLCG      1 - 70
GFYPRLSCCLRSDSPGLGRLENKIFSVTNNTECGKLLEEIKCALCSPHSQSLFHSPEREVLERDLVLPLL     71 - 140
CKDYCKEFFYTCRGHIPGFLQTTADEFCFYYARKDGGLCFPDFPRKQVRGPASNYLDQMEEYDKVEEISR    141 - 210
KHKHNCFCIQEVVSGLRQPVGALHSGDGSQRLFILEKEGYVKILTPEGEIFKEPYLDIHKLVQSGIKGGD    211 - 280
ERGLLSLAFHPNYKKNGKLYVSYTTNQERWAIGPHDHILRVVEYTVSRKNPHQVDLRTARVFLEVAELHR    281 - 350
KHLGGQLLFGPDGFLYIILGDGMITLDDMEEMDGLSDFTGSVLRLDVDTDMCNVPYSIPRSNPHFNSTNQ    351 - 420
PPEVFAHGLHDPGRCAVDRHPTDININLTILCSDSNGKNRSSARILQIIKGKDYESEPSLLEFKPFSNGP    421 - 490
LVGGFVYRGCQSERLYGSYVFGDRNGNFLTLQQSPVTKQWQEKPLCLGTSGSCRGYFSGHILGFGEDELG    491 - 560
EVYILSSSKSMTQTHNGKLYKIVDPKRPLMPEECRATVQPAQTLTSECSRLCRNGYCTPTGKCCCSPGWE    561 - 630
GDFCRTAKCEPACRHGGVCVRPNKCLCKKGYLGPQCEQVDRNIRRVTRAGILDQIIDMTSYLLDLTSYIV    631 - 700
//

Text Mined References (64)

PMID Year Title
26527870 2015 Candidate genes for COPD: current evidence and research.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25416442 2015 Epigenetic regulation of human hedgehog interacting protein in glioma cell lines and primary tumor samples.
25281659 2015 A novel common variant in DCST2 is associated with length in early life and height in adulthood.
25215859 2014 Shh-mediated degradation of Hhip allows cell autonomous and non-cell autonomous Shh signalling.
25101718 2015 IREB2 and GALC are associated with pulmonary artery enlargement in chronic obstructive pulmonary disease.
25006744 2014 Genome-wide association identifies regulatory Loci associated with distinct local histogram emphysema patterns.
24621683 2014 Risk loci for chronic obstructive pulmonary disease: a genome-wide association study and meta-analysis.
24439425 2014 The glypican 3 hepatocellular carcinoma marker regulates human hepatic stellate cells via Hedgehog signaling.
23994291 2013 Association of HHIP polymorphisms with COPD and COPD-related phenotypes in a Chinese Han population.
23935859 2013 Molecular dynamics simulations of sonic hedgehog-receptor and inhibitor complexes and their applications for potential anticancer agent discovery.
23780909 2013 Mutations in Hedgehog pathway genes in fetal rhabdomyomas.
23731023 2013 Genetic variants in HHIP are associated with FEV1 in subjects with chronic obstructive pulmonary disease.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23459001 2013 Gene expression analysis uncovers novel hedgehog interacting protein (HHIP) effects in human bronchial epithelial cells.
23456936 2013 HHIP, HDAC4, NCR3 and RARB polymorphisms affect fetal, childhood and adult lung function.
23440386 2013 Altered expression of PTCH and HHIP in gastric cancer through their gene promoter methylation: novel targets for gastric cancer.
23284291 2012 Genome-wide joint meta-analysis of SNP and SNP-by-smoking interaction identifies novel loci for pulmonary function.
22897141 2013 Single-nucleotide variants in two Hedgehog genes, SHH and HHIP, as genetic cause of combined pituitary hormone deficiency.
22457212 2012 Hedgehog signaling inhibition by the small molecule smoothened inhibitor GDC-0449 in the bone forming prostate cancer xenograft MDA PCa 118b.
22406999 2012 Hedgehog signaling in glioblastoma multiforme.
22301921 2011 Resveratrol inhibits proliferation and induces apoptosis through the hedgehog signaling pathway in pancreatic cancer cell.
22140090 2012 Identification of a chronic obstructive pulmonary disease genetic determinant that regulates HHIP.
22080838 2012 A genome-wide association study of COPD identifies a susceptibility locus on chromosome 19q13.
21397937 2011 Importance of hedgehog interacting protein and other lung function genes in asthma.
21210262 2011 Identification of signature genes for detecting hedgehog pathway activation in esophageal cancer.
21119205 2010 Chromosome 4q31 locus in COPD is also associated with lung cancer.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20853133 2011 Human hedgehog interacting protein expression and promoter methylation in medulloblastoma cell lines and primary tumor samples.
20846217 2010 Association of linear growth impairment in pediatric Crohn's disease and a known height locus: a pilot study.
20800318 2012 The molecular genetics underlying basal cell carcinoma pathogenesis and links to targeted therapeutics.
20656943 2010 Loci identified by genome-wide association studies influence different disease-related phenotypes in chronic obstructive pulmonary disease.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
20397748 2010 Genome-wide association study of height and body mass index in Australian twin families.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20173748 2010 Variants in FAM13A are associated with chronic obstructive pulmonary disease.
20010835 2010 Meta-analyses of genome-wide association studies identify multiple loci associated with pulmonary function.
20010834 2010 Genome-wide association study identifies five loci associated with lung function.
19996190 2010 Hedgehog-interacting protein is a COPD susceptibility gene: the Rotterdam Study.
19915594 2009 Modulating hedgehog signaling can attenuate the severity of osteoarthritis.
19893584 2010 Identification of 15 loci influencing height in a Korean population.
19561611 2009 Structural insights into hedgehog ligand sequestration by the human hedgehog-interacting protein HHIP.
19561609 2009 The structure of SHH in complex with HHIP reveals a recognition role for the Shh pseudo active site in signaling.
19343178 2009 Meta-analysis of genome-wide scans for human adult stature identifies novel Loci and associations with measures of skeletal frame size.
19300500 2009 A genome-wide association study of pulmonary function measures in the Framingham Heart Study.
19300482 2009 A genome-wide association study in chronic obstructive pulmonary disease (COPD): identification of two major susceptibility loci.
19266077 2009 Genetic determinants of height growth assessed longitudinally from infancy to adulthood in the northern Finland birth cohort 1966.
19252479 2009 A mutation in Ihh that causes digit abnormalities alters its signalling capacity and range.
18559595 2008 Down-regulation of hedgehog-interacting protein through genetic and epigenetic alterations in human hepatocellular carcinoma.
18391952 2008 Genome-wide association analysis identifies 20 loci that influence adult height.
18391951 2008 Many sequence variants affecting diversity of adult human height.
18391950 2008 Identification of ten loci associated with height highlights new biological pathways in human growth.
15970691 2005 Aberrant methylation of the Human Hedgehog interacting protein (HHIP) gene in pancreatic neoplasms.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15754313 2005 Localization of the human hedgehog-interacting protein (Hip) in the normal and diseased pancreas.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15294024 2004 Hedgehog-interacting protein is highly expressed in endothelial cells but down-regulated during angiogenesis and in several human tumors.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11731473 2001 Hedgehog signaling in animal development: paradigms and principles.
11472839 2001 Comparative biological responses to human Sonic, Indian, and Desert hedgehog.
11435703 2001 The human hedgehog-interacting protein gene: structure and chromosome mapping to 4q31.21-->q31.3.
10050855 1999 Vertebrate Hedgehog signalling modulated by induction of a Hedgehog-binding protein.