Property Summary

NCBI Gene PubMed Count 157
PubMed Score 1034.49
PubTator Score 509.20

Knowledge Summary

Patent

No data available

Expression

Gene RIF (152)

PMID Text
27052408 Data suggest that hematopoietically expressed homeobox protein (HHEX) downmodulation by promyelocytic leukemia-retinoic acid receptor alpha fusion oncoprotein (PML-RARalpha) is a key event during acute promyelocytic leukemia (APL) pathogenesis.
26728554 Hhex binds to the Cdkn2a locus and directly interacts with the Polycomb-repressive complex 2 (PRC2) to enable H3K27me3-mediated epigenetic repression
25220416 Data suggest that Hhex is a novel regulator of c-Myc function that limits c-Myc activity in transformed cells.
24651531 HHEX promotes hepatic specification by repressing EOMES expression.
24240683 PRH controls the migration of multiple epithelial cell lineages in part at least through the direct transcriptional regulation of Endoglin
24112421 Data indicate the potential importance of CDKAL1 protein and homeobox protein HHEX in glucose homeostasis in this Alaska Native population with a low prevalence of type 2 diabetes (T2D).
23929257 In all the CHD patients, we did not find any causative mutations in the coding region of the HHEX gene.
23445342 Tissue-specific knockdown of the HHEX ortholog dHHEX (CG7056) directed metabolic defects and enhanced lethality; for example, fat-body-specific loss of dHHEX led to increased hemolymph glucose and reduced insulin sensitivity
23349771 Data indicate associations of SNPs in eight loci CXCR4, HHEX, FOXA2, NGN3, TCF7L2, FLJ39370 (C4orf32), LOC646279 (RPL21P7) and THADA with body mass index (BMI) and weight.
23166797 A significant association of rs1111875, rs5015480 and rs7923837 in HHEX gene with type 2 diabetes.
23036584 In conclusion, this epistatic interaction showed a high degree of consistency when stratifying by sex, the epsilon4 allele of apolipoprotein E genotype, and geographic region.
22923468 Association to type 2 diabetes was found for rs13266634 (SLC30A8), rs7923837 (HHEX), rs10811661 (CDKN2A/2B), rs4402960 (IGF2BP2), rs12779790 (CDC123/CAMK1D), and rs2237892 (KCNQ1).
22874537 re-establishment of gene control by PRH is in part responsible for the therapeutic effects of dasatinib.
22540015 The proline rich homeodomain protein PRH/Hhex forms predominantly octameric and/or hexadecameric species in solution as well as larger assemblies.
22506066 Genetic variants of the IDE-KIF11-HHEX region at 10q23.33 contribute to type 2 diabetes susceptibility.
22487833 The associations between SNPs of TCF7L2, CDKAL1, SLC30A8 and HHEX and the development of DR and DN.
22443257 None of the 12 SNPs in the six genes (KCNJ11, TCF7L2, SLC30A8, HHEX, FTO and CDKAL1) uncovered in the genome-wide association studies were associated with polycystic ovary syndrome.
21656028 Loss of HHEX is associated with colorectal cancer.
21510814 HHEX, is more likely to represent the genuine signals of T2DM in the Tunisian population.
21368910 Single nucleotide polymorphism (SNP) analysis revealed that the sequence variant (rs5015480) near HHEX and two SNPs (rs7756992 and rs9465871) in CDKAL1 were associated with the susceptibility of type 2 diabetes mellitus in females, but not in males.
21059810 Meta-analysis of gene-disease association. (HuGE Navigator)
21056935 Meta-analysis of gene-disease association. (HuGE Navigator)
20929593 Observational study of gene-disease association. (HuGE Navigator)
20927120 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20889853 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20879858 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20816152 Observational study of gene-disease association. (HuGE Navigator)
20802253 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20724036 Observational study of gene-disease association. (HuGE Navigator)
20712903 Observational study of gene-disease association. (HuGE Navigator)
20703447 HHEX, IDE and SLC30A8 showed strongest tissue-specific mRNA expression bias and are associated with increased risk of type 2 diabete.
20647405 Our data indicate that common genetic variants in two genes previously related to obesity (FTO) and diabetes (HHEX) by genome-wide association scans were not associated with endometrial cancer risk.
20647405 Observational study of gene-disease association. (HuGE Navigator)
20616309 Observational study of gene-disease association. (HuGE Navigator)
20597906 Observational study of gene-disease association. (HuGE Navigator)
20580033 Observational study of gene-disease association. (HuGE Navigator)
20571754 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20550665 Observational study of gene-disease association. (HuGE Navigator)
20509872 Observational study of gene-disease association. (HuGE Navigator)
20503258 Observational study of gene-disease association. (HuGE Navigator)
20490451 Data report a novel association between the fetal ADCY5 type 2 diabetes risk allele and decreased birthweight, and confirm in meta-analyses associations between decreased birthweight and the type 2 diabetes risk alleles of HHEX-IDE and CDKAL1.
20490451 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20460429 Type 2 diabetes susceptibility alleles at HHEX are associated with low body mass index at 8 years in children who were born large for gestational age.
20460429 Observational study of gene-disease association. (HuGE Navigator)
20424228 Observational study of gene-disease association. (HuGE Navigator)
20384434 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20215779 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20203524 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20176809 PRH is a key regulator of the VEGF signaling pathway and describe a mechanism whereby PRH plays an important role in tumorigenesis and leukemogenesis.
20161779 Observational study of gene-disease association. (HuGE Navigator)
20080751 HHEX has been implicated in pancreas development and the regulation of insulin secretion and risk of type 2 diabetes.
20075150 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
20043145 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20041287 There was no association of the genetic polymorhism rs1111875 of HHEX with the occurrence of polycystic ovary syndrome in the Chinese population.
20041287 Observational study of gene-disease association. (HuGE Navigator)
20028982 the interaction between Hhex and SOX13 may contribute to control Wnt/TCF1 signaling in the early embryo.
19956635 Uncategorized study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19933996 the same genetic HHEX-IDE variant, which is associated with type 2 diabetes from previous studies, also influences pediatric body mass index
19933996 Observational study of gene-disease association. (HuGE Navigator)
19892838 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19862325 there is an association between PPARG, KCNJ11, CDKAL1, CDKN2A-CDKN2B, IDE-KIF11-HHEX, IGF2BP2 and SLC30A8 and type 2 diabetes in the Chinese population
19862325 Observational study of gene-disease association. (HuGE Navigator)
19808892 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19794065 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19741467 Observational study of gene-disease association. (HuGE Navigator)
19741166 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19720844 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19622614 The association of low birth weight and type 2 diabetes risk alleles of the HHEX-IDE locus is confirmed in children of mothers with type 1 diabetes.
19622614 Observational study of gene-disease association. (HuGE Navigator)
19602701 Meta-analysis and HuGE review of gene-disease association. (HuGE Navigator)
19592620 Observational study of gene-disease association. (HuGE Navigator)
19502414 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19401414 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19380854 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19368707 Observational study of gene-disease association. (HuGE Navigator)
19336475 Observational study of gene-disease association. (HuGE Navigator)
19324937 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19279076 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19258437 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19258404 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19247372 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19228808 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19225753 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19172244 Observational study of gene-disease association. (HuGE Navigator)
19139842 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19117022 Variations within the HHEX gene conferred the impaired insulin secretion and changes of insulin degradation but no alteration in insulin sensitivity in carriers of risk for gluccose intolerance.
19117022 Observational study of gene-disease association. (HuGE Navigator)
19082521 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19072826 HEX/Hex is a novel bile acid-induced FXR/Fxr target gene during adaptation of hepatocytes to chronic bile acid exposure.
19053027 Located on chromosome 10 and suscptibility of polymorphisms are related to type 2 diabetes.
19033397 Type 2 diabetes susceptibility of HHEX was confirmed in Japanese.
19033397 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19020324 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19020323 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19008344 Data show that SNPs in HHEX did not confer a significant risk for type 2 diabetes in Pima Indians.
19008344 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19002430 Observational study of gene-disease association. (HuGE Navigator)
18991055 Single nucleotide polymorphism in HHEX is associated with type 2 diabetes.
18991055 Observational study of gene-disease association. (HuGE Navigator)
18984664 Observational study of gene-disease association. (HuGE Navigator)
18755198 PRH octamers wrap DNA in order to bring about transcriptional repression
18719881 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18713067 Results demonstrate that transcriptional repression by PRH is dependent on TLE availability and suggest that subnuclear localization of TLE plays an important role in transcriptional repression by PRH.
18633108 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18618095 Observational study of gene-disease association. (HuGE Navigator)
18598350 Observational study of gene-disease association. (HuGE Navigator)
18597214 Gene variants of CDKAL1, PPARG, IGF2BP2, HHEX, TCF7L2, and FTO predispose to type 2 diabetes in the German KORA 500 K study population.
18597214 Observational study of gene-disease association. (HuGE Navigator)
18591388 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18544707 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18516622 Observational study of gene-disease association. (HuGE Navigator)
18477659 Observational study of gene-disease association. (HuGE Navigator)
18469204 Data confirmed the associations of single nucleotide polymorphisms in HHEX with risk for type 2 diabetes in Asians.
18469204 Observational study of gene-disease association. (HuGE Navigator)
18461161 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18437351 Observational study of gene-disease association. (HuGE Navigator)
18426861 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18388181 translocation involving nucleoporin 98 (NUP98) fused to the DNA-binding domain of the hematopoietically expressed homeobox gene found in acute myeloid leukemia
18231124 variants near the HHEX gene contribute to the risk of type 2 diabetes in a Dutch population
18231124 Observational study of gene-disease association. (HuGE Navigator)
18210030 Observational study of gene-disease association. (HuGE Navigator)
18162508 The association of 6 loci with type 2 diabetes risk in Japanese patients is reported.
18162508 Observational study of gene-disease association. (HuGE Navigator)
18039816 Single nucleotid polymorphismallele represents a risk allele for beta-cell dysfunction and, mayconfer increased susceptibility of beta-cells toward adverse environmental factors and type 2 diabetes.
18039816 Observational study of gene-disease association. (HuGE Navigator)
17971426 Observational study of gene-disease association. (HuGE Navigator)
17971426 Single-nucleotide polymorphisms in the HHEX gene are associated with susceptibility to type 2 diaabetes across the boundary of race.
17928989 HHEX is a common type 2 diabetes-susceptibility gene across different ethnic groups.
17928989 Observational study of gene-disease association. (HuGE Navigator)
17827400 Observational study of gene-disease association. (HuGE Navigator)
17827400 Variations confer impaired glucose- and tolbutamide-induced insulin release in middle-aged and young healthy subjects.
17804762 Observational study of gene-disease association. (HuGE Navigator)
17804762 CDKAL1 and HHEX/IDE diabetes-associated alleles are associated with decreased pancreatic beta-cell function, including decreased beta-cell glucose sensitivity that relates insulin secretion to plasma glucose concentration.
17786204 Observational study of gene-disease association. (HuGE Navigator)
17632701 Genetic variation predisposes to type 2 diabetes.
17618412 Variations are not linked to diabetes mellitus.
17463249 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
17463248 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17463246 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17293876 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
16854221 HEX may play a role in differentiation of the epithelial breast cell
16540119 region of PRH contains a novel proline-rich dimerisation domain that mediates oligomerisation
15242862 Hex, a hematopoietically expressed homeobox protein, induces transcription of the SM22alpha gene by facilitating the interaction between SRF and its cognate binding site in embryonic fibroblasts.
15062550 Pax8 regulates the transcriptional activity of Hex promoter; several Pax8 binding sites in the Hex promoter are present
15024728 Observational study of gene-disease association. (HuGE Navigator)
15016828 Tgf-beta mediated repression of flk-1/KDR and mediated repression of flk-1/KDR and VEGF signaling involves the inducible formation of inhibitory Hex-GATA signaling Hex-GATA involves the formation of Hex-GATA complexes.
14555989 Hex can act as a T lineage oncogene when misexpressed in hematopoietic precursor cells
14517947 Observational study of gene-disease association. (HuGE Navigator)
12826010 PRH interacts with the HC8 subunit of the proteasome in the context of both 20 and 26 S proteasomes and is associated with the proteasome in K562 hematopoietic cells; the proline-rich PRH N-terminal domain is responsible for this interaction.
12588764 HEX may not affect the differentiation of endothelial cells but acts as a negative regulator of angiogenesis.
12554669 PRH is a negative regulator of eIF4E in myeloid cells, interacting with eIF4E through a conserved binding site typically found in translational regulators
11701950 genomic organization and chromosome 10 mapping

AA Sequence

MQYPHPGPAAGAVGVPLYAPTPLLQPAHPTPFYIEDILGRGPAAPTPAPTLPSPNSSFTSLVSPYRTPVY      1 - 70
EPTPIHPAFSHHSAAALAAAYGPGGFGGPLYPFPRTVNDYTHALLRHDPLGKPLLWSPFLQRPLHKRKGG     71 - 140
QVRFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRRLKQENPQSNKKEELES    141 - 210
LDSSCDQRQDLPSEQNKGASLDSSQCSPSPASQEDLESEISEDSDQEVDIEGDKSYFNAG              211 - 270
//

Text Mined References (160)

PMID Year Title
27052408 2016 PML-RAR alpha induces the downmodulation of HHEX: a key event responsible for the induction of an angiogenetic response.
26728554 2016 Acute myeloid leukemia requires Hhex to enable PRC2-mediated epigenetic repression of Cdkn2a.
25416956 2014 A proteome-scale map of the human interactome network.
25220416 2015 Growth-promoting and tumourigenic activity of c-Myc is suppressed by Hhex.
24651531 2014 HHEX promotes hepatic-lineage specification through the negative regulation of eomesodermin.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
24240683 2014 PRH/HHex inhibits the migration of breast and prostate epithelial cells through direct transcriptional regulation of Endoglin.
24112421 2014 CDKAL1 and HHEX are associated with type 2 diabetes-related traits among Yup'ik people.
23945395 2014 Genome-wide association study identifies three novel loci for type 2 diabetes.
23929257 2013 The HHEX gene is not related to congenital heart disease in 296 Chinese patients.
23445342 2013 A Drosophila functional evaluation of candidates from human genome-wide association studies of type?2?diabetes and related metabolic traits identifies tissue-specific roles for dHHEX.
23349771 2013 Association study of 25 type 2 diabetes related Loci with measures of obesity in Indian sib pairs.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23166797 2012 Hematopoietically-expressed homeobox gene three widely-evaluated polymorphisms and risk for diabetes: a meta-analysis.
23036584 2013 Discovery by the Epistasis Project of an epistatic interaction between the GSTM3 gene and the HHEX/IDE/KIF11 locus in the risk of Alzheimer's disease.
22923468 2012 Contribution of common genetic variation to the risk of type 2 diabetes in the Mexican Mestizo population.
22874537 2012 Dasatinib inhibits leukaemic cell survival by decreasing PRH/Hhex phosphorylation resulting in increased repression of VEGF signalling genes.
22693455 2012 Stratifying type 2 diabetes cases by BMI identifies genetic risk variants in LAMA1 and enrichment for risk variants in lean compared to obese cases.
22540015 2012 The proline rich homeodomain protein PRH/Hhex forms stable oligomers that are highly resistant to denaturation.
22506066 2012 Genetic variants of IDE-KIF11-HHEX at 10q23.33 associated with type 2 diabetes risk: a fine-mapping study in Chinese population.
22487833 2012 [Association analysis of genetic polymorphisms of TCF7L2, CDKAL1, SLC30A8, HHEX genes and microvascular complications of type 2 diabetes mellitus].
22443257 2012 Polycystic ovary syndrome is not associated with polymorphisms of the TCF7L2, CDKAL1, HHEX, KCNJ11, FTO and SLC30A8 genes.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
21656028 2012 A potential role for the homeoprotein Hhex in hepatocellular carcinoma progression.
21533175 2011 Eight common genetic variants associated with serum DHEAS levels suggest a key role in ageing mechanisms.
21510814 2011 Association of genetic variations in TCF7L2, SLC30A8, HHEX, LOC387761, and EXT2 with Type 2 diabetes mellitus in Tunisia.
21368910 2011 Heterogeneity of genetic associations of CDKAL1 and HHEX with susceptibility of type 2 diabetes mellitus by gender.
21059810 2011 Meta-analysis of the effect of HHEX gene polymorphism on the risk of type 2 diabetes.
21056935 2011 Quantitative assessment of the influence of hematopoietically expressed homeobox variant (rs1111875) on type 2 diabetes risk.
20929593 2010 The longitudinal association of common susceptibility variants for type 2 diabetes and obesity with fasting glucose level and BMI.
20927120 2010 Variations in/nearby genes coding for JAZF1, TSPAN8/LGR5 and HHEX-IDE and risk of type 2 diabetes in Han Chinese.
20889853 2011 Genetic risk reclassification for type 2 diabetes by age below or above 50 years using 40 type 2 diabetes risk single nucleotide polymorphisms.
20879858 2010 Impact of single nucleotide polymorphisms and of clinical risk factors on new?onset diabetes mellitus in HIV?infected individuals.
20862305 2010 Identification of new genetic risk variants for type 2 diabetes.
20816152 2010 Obesity and diabetes genetic variants associated with gestational weight gain.
20802253 2010 Glycemia determines the effect of type 2 diabetes risk genes on insulin secretion.
20724036 2012 Association between variants in IDE-KIF11-HHEX and plasma amyloid ? levels.
20712903 2010 Obesity and diabetes genes are associated with being born small for gestational age: results from the Auckland Birthweight Collaborative study.
20703447 2010 Expression analysis of loci associated with type 2 diabetes in human tissues.
20647405 2010 No association between FTO or HHEX and endometrial cancer risk.
20616309 2010 Coronary artery calcification and its relationship to validated genetic variants for diabetes mellitus assessed in the Heinz Nixdorf recall cohort.
20597906 2010 A validation study of type 2 diabetes-related variants of the TCF7L2, HHEX, KCNJ11, and ADIPOQ genes in one endogamous ethnic group of north India.
20581827 2010 Twelve type 2 diabetes susceptibility loci identified through large-scale association analysis.
20580033 2010 Replication of recently described type 2 diabetes gene variants in a South Indian population.
20571754 2010 Evaluating the discriminative power of multi-trait genetic risk scores for type 2 diabetes in a northern Swedish population.
20550665 2010 Association study of genetic variants in eight genes/loci with type 2 diabetes in a Han Chinese population.
20509872 2010 Implication of genetic variants near SLC30A8, HHEX, CDKAL1, CDKN2A/B, IGF2BP2, FTO, TCF2, KCNQ1, and WFS1 in type 2 diabetes in a Chinese population.
20503258 2010 Candidate gene association study conditioning on individual ancestry in patients with type 2 diabetes and metabolic syndrome from Mexico City.
20490451 2010 Type 2 diabetes risk alleles near ADCY5, CDKAL1 and HHEX-IDE are associated with reduced birthweight.
20460429 2010 BMI at age 8 years is influenced by the type 2 diabetes susceptibility genes HHEX-IDE and CDKAL1.
20424228 2010 Impact of common variants of PPARG, KCNJ11, TCF7L2, SLC30A8, HHEX, CDKN2A, IGF2BP2, and CDKAL1 on the risk of type 2 diabetes in 5,164 Indians.
20384434 2010 Combining genetic markers and clinical risk factors improves the risk assessment of impaired glucose metabolism.
20215779 2009 Evidence of interaction between type 2 diabetes susceptibility genes and dietary fat intake for adiposity and glucose homeostasis-related phenotypes.
20203524 2010 Genetic susceptibility to type 2 diabetes is associated with reduced prostate cancer risk.
20176809 2010 PRH/Hhex controls cell survival through coordinate transcriptional regulation of vascular endothelial growth factor signaling.
20161779 2010 Investigation of type 2 diabetes risk alleles support CDKN2A/B, CDKAL1, and TCF7L2 as susceptibility genes in a Han Chinese cohort.
20080751 2010 Long-range gene regulation links genomic type 2 diabetes and obesity risk regions to HHEX, SOX4, and IRX3.
20075150 2010 Utility of genetic and non-genetic risk factors in prediction of type 2 diabetes: Whitehall II prospective cohort study.
20043145 2010 Improvements in glucose homeostasis in response to regular exercise are influenced by the PPARG Pro12Ala variant: results from the HERITAGE Family Study.
20041287 2010 Polymorphisms of TCF7L2 and HHEX genes in Chinese women with polycystic ovary syndrome.
20028982 2010 Interaction between Hhex and SOX13 modulates Wnt/TCF activity.
19956635 2009 Fulfilling the promise of personalized medicine? Systematic review and field synopsis of pharmacogenetic studies.
19933996 2010 Examination of all type 2 diabetes GWAS loci reveals HHEX-IDE as a locus influencing pediatric BMI.
19892838 2010 Polymorphisms identified through genome-wide association studies and their associations with type 2 diabetes in Chinese, Malays, and Asian-Indians in Singapore.
19862325 2009 PPARG, KCNJ11, CDKAL1, CDKN2A-CDKN2B, IDE-KIF11-HHEX, IGF2BP2 and SLC30A8 are associated with type 2 diabetes in a Chinese population.
19808892 2010 Combined risk allele score of eight type 2 diabetes genes is associated with reduced first-phase glucose-stimulated insulin secretion during hyperglycemic clamps.
19794065 2010 Polygenic risk variants for type 2 diabetes susceptibility modify age at diagnosis in monogenic HNF1A diabetes.
19741467 2009 Association of common type 2 diabetes risk gene variants and posttransplantation diabetes mellitus in renal allograft recipients in Korea.
19741166 2009 Common genetic determinants of glucose homeostasis in healthy children: the European Youth Heart Study.
19720844 2009 Use of multiple metabolic and genetic markers to improve the prediction of type 2 diabetes: the EPIC-Potsdam Study.
19622614 2009 HHEX-IDE polymorphism is associated with low birth weight in offspring with a family history of type 1 diabetes.
19602701 2009 Underlying genetic models of inheritance in established type 2 diabetes associations.
19592620 2009 Examination of type 2 diabetes loci implicates CDKAL1 as a birth weight gene.
19502414 2009 Association of 18 confirmed susceptibility loci for type 2 diabetes with indices of insulin release, proinsulin conversion, and insulin sensitivity in 5,327 nondiabetic Finnish men.
19401414 2009 Confirmation of multiple risk Loci and genetic impacts by a genome-wide association study of type 2 diabetes in the Japanese population.
19380854 2009 Joint effects of common genetic variants on the risk for type 2 diabetes in U.S. men and women of European ancestry.
19368707 2009 Contribution of type 2 diabetes associated loci in the Arabic population from Tunisia: a case-control study.
19336475 2009 Integrated associations of genotypes with multiple blood biomarkers linked to coronary heart disease risk.
19324937 2009 Previously associated type 2 diabetes variants may interact with physical activity to modify the risk of impaired glucose regulation and type 2 diabetes: a study of 16,003 Swedish adults.
19324893 2009 CK2 phosphorylation of the PRH/Hex homeodomain functions as a reversible switch for DNA binding.
19279076 2009 Genetic predisposition, Western dietary pattern, and the risk of type 2 diabetes in men.
19258437 2009 Genetic variant in the IGF2BP2 gene may interact with fetal malnutrition to affect glucose metabolism.
19258404 2009 The inhibitory effect of recent type 2 diabetes risk loci on insulin secretion is modulated by insulin sensitivity.
19247372 2009 Construction of a prediction model for type 2 diabetes mellitus in the Japanese population based on 11 genes with strong evidence of the association.
19228808 2009 Type 2 diabetes risk alleles are associated with reduced size at birth.
19225753 2009 Interaction between prenatal growth and high-risk genotypes in the development of type 2 diabetes.
19172244 2009 The risk allele load accelerates the age-dependent decline in beta cell function.
19139842 2009 Risk prediction of prevalent diabetes in a Swiss population using a weighted genetic score--the CoLaus Study.
19117022 2009 The influence of genetic variations in HHEX gene on insulin metabolism in the German MESYBEPO cohort.
19082521 2009 Association between insulin secretion, insulin sensitivity and type 2 diabetes susceptibility variants identified in genome-wide association studies.
19072826 2009 Hematopoietically expressed homeobox is a target gene of farnesoid X receptor in chenodeoxycholic acid-induced liver hypertrophy.
19053027 2009 Loci of TCF7L2, HHEX and IDE on chromosome 10q and the susceptibility of their genetic polymorphisms to type 2 diabetes.
19033397 2009 Replication study of candidate genes associated with type 2 diabetes based on genome-wide screening.
19020324 2008 Clinical risk factors, DNA variants, and the development of type 2 diabetes.
19020323 2008 Genotype score in addition to common risk factors for prediction of type 2 diabetes.
19008344 2009 Association analysis of variation in/near FTO, CDKAL1, SLC30A8, HHEX, EXT2, IGF2BP2, LOC387761, and CDKN2B with type 2 diabetes and related quantitative traits in Pima Indians.
19002430 2009 Type 2 diabetes-associated genetic variants discovered in the recent genome-wide association studies are related to gestational diabetes mellitus in the Korean population.
18991055 2008 Association between polymorphisms in SLC30A8, HHEX, CDKN2A/B, IGF2BP2, FTO, WFS1, CDKAL1, KCNQ1 and type 2 diabetes in the Korean population.
18984664 2009 Common type 2 diabetes risk gene variants associate with gestational diabetes.
18755198 2008 DNA wrapping and distortion by an oligomeric homeodomain protein.
18719881 2008 Beta cell glucose sensitivity is decreased by 39% in non-diabetic individuals carrying multiple diabetes-risk alleles compared with those with no risk alleles.
18713067 2009 The PRH/Hex repressor protein causes nuclear retention of Groucho/TLE co-repressors.
18633108 2008 Common variants in CDKAL1, CDKN2A/B, IGF2BP2, SLC30A8, and HHEX/IDE genes are associated with type 2 diabetes and impaired fasting glucose in a Chinese Han population.
18618095 2008 Variants of CDKAL1 and IGF2BP2 affect first-phase insulin secretion during hyperglycaemic clamps.
18598350 2008 Impact of nine common type 2 diabetes risk polymorphisms in Asian Indian Sikhs: PPARG2 (Pro12Ala), IGF2BP2, TCF7L2 and FTO variants confer a significant risk.
18597214 2008 Variants of the PPARG, IGF2BP2, CDKAL1, HHEX, and TCF7L2 genes confer risk of type 2 diabetes independently of BMI in the German KORA studies.
18591388 2008 Assessing the combined impact of 18 common genetic variants of modest effect sizes on type 2 diabetes risk.
18544707 2008 Extension of type 2 diabetes genome-wide association scan results in the diabetes prevention program.
18516622 2008 Type 2 diabetes susceptibility loci in the Ashkenazi Jewish population.
18477659 2008 Replication of genome-wide association studies of type 2 diabetes susceptibility in Japan.
18469204 2008 Implication of genetic variants near TCF7L2, SLC30A8, HHEX, CDKAL1, CDKN2A/B, IGF2BP2, and FTO in type 2 diabetes and obesity in 6,719 Asians.
18461161 2008 Post genome-wide association studies of novel genes associated with type 2 diabetes show gene-gene interaction and high predictive value.
18437351 2008 Genetic analysis of recently identified type 2 diabetes loci in 1,638 unselected patients with type 2 diabetes and 1,858 control participants from a Norwegian population-based cohort (the HUNT study).
18426861 2008 Association analysis of type 2 diabetes Loci in type 1 diabetes.
18388181 2008 Leukemogenic mechanisms and targets of a NUP98/HHEX fusion in acute myeloid leukemia.
18372903 2008 Meta-analysis of genome-wide association data and large-scale replication identifies additional susceptibility loci for type 2 diabetes.
18231124 2008 HHEX gene polymorphisms are associated with type 2 diabetes in the Dutch Breda cohort.
18210030 2008 Analysis of novel risk loci for type 2 diabetes in a general French population: the D.E.S.I.R. study.
18162508 2008 Association of CDKAL1, IGF2BP2, CDKN2A/B, HHEX, SLC30A8, and KCNJ11 with susceptibility to type 2 diabetes in a Japanese population.
18039816 2008 A candidate type 2 diabetes polymorphism near the HHEX locus affects acute glucose-stimulated insulin release in European populations: results from the EUGENE2 study.
17971426 2008 Polymorphisms in the IDE-KIF11-HHEX gene locus are reproducibly associated with type 2 diabetes in a Japanese population.
17928989 2007 Variations in the HHEX gene are associated with increased risk of type 2 diabetes in the Japanese population.
17827400 2007 Studies of association of variants near the HHEX, CDKN2A/B, and IGF2BP2 genes with type 2 diabetes and impaired insulin release in 10,705 Danish subjects: validation and extension of genome-wide association studies.
17804762 2007 Common variants of the novel type 2 diabetes genes CDKAL1 and HHEX/IDE are associated with decreased pancreatic beta-cell function.
17786204 2007 Polymorphisms within novel risk loci for type 2 diabetes determine beta-cell function.
17632701 2007 Variation in the HHEX-IDE gene region predisposes to type 2 diabetes in the prospective, population-based EPIC-Potsdam cohort.
17618412 2007 Mutations in HHEX are not a common cause of monogenic forms of beta cell dysfunction.
17463249 2007 Replication of genome-wide association signals in UK samples reveals risk loci for type 2 diabetes.
17463248 2007 A genome-wide association study of type 2 diabetes in Finns detects multiple susceptibility variants.
17463246 2007 Genome-wide association analysis identifies loci for type 2 diabetes and triglyceride levels.
17293876 2007 A genome-wide association study identifies novel risk loci for type 2 diabetes.
16854221 2006 HEX expression and localization in normal mammary gland and breast carcinoma.
16582099 2006 The high-mobility-group domain of Sox proteins interacts with DNA-binding domains of many transcription factors.
16540119 2006 Oligomerisation of the developmental regulator proline rich homeodomain (PRH/Hex) is mediated by a novel proline-rich dimerisation domain.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15242862 2004 Homeobox protein Hex facilitates serum responsive factor-mediated activation of the SM22alpha gene transcription in embryonic fibroblasts.
15187083 2004 The proline-rich homeodomain protein recruits members of the Groucho/Transducin-like enhancer of split protein family to co-repress transcription in hematopoietic cells.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15062550 2004 Functional interaction among thyroid-specific transcription factors: Pax8 regulates the activity of Hex promoter.
15024728 2004 Genetic variants in a haplotype block spanning IDE are significantly associated with plasma Abeta42 levels and risk for Alzheimer disease.
15016828 2004 Interaction between hex and GATA transcription factors in vascular endothelial cells inhibits flk-1/KDR-mediated vascular endothelial growth factor signaling.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14555989 2003 The homeobox gene Hex induces T-cell-derived lymphomas when overexpressed in hematopoietic precursor cells.
14517947 2003 Genetic variation in a haplotype block spanning IDE influences Alzheimer disease.
12826010 2003 The transcriptional repressor protein PRH interacts with the proteasome.
12655000 2003 Thyroid-specific transcription factors control Hex promoter activity.
12588764 2003 HEX acts as a negative regulator of angiogenesis by modulating the expression of angiogenesis-related gene in endothelial cells in vitro.
12554669 2003 The proline-rich homeodomain protein, PRH, is a tissue-specific inhibitor of eIF4E-dependent cyclin D1 mRNA transport and growth.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11889211 2002 Expression and localization of the homeodomain-containing protein HEX in human thyroid tumors.
11701950 2001 Genomic organization and chromosome mapping of the human homeobox gene HHEX.
11551904 2001 Functional interaction of Jun and homeodomain proteins.
10871399 2000 Expression and function of the homeodomain-containing protein Hex in thyroid cells.
10597310 1999 The promyelocytic leukemia protein PML interacts with the proline-rich homeodomain protein PRH: a RING may link hematopoiesis and growth control.
8103988 1993 PCR cloning of an orphan homeobox gene (PRH) preferentially expressed in myeloid and liver cells.
8096636 1993 HEX: a novel homeobox gene expressed during haematopoiesis and conserved between mouse and human.
7911091 1994 A homology-based molecular model of the proline-rich homeodomain protein Prh, from haematopoietic cells.
7858254 1995 Differential expression of a novel proline-rich homeobox gene (Prh) in human hematolymphopoietic cells.
1360645 1992 Identification of a novel vertebrate homeobox gene expressed in haematopoietic cells.