Property Summary

NCBI Gene PubMed Count 5
PubMed Score 5.81
PubTator Score 0.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -2.000 2.5e-03
astrocytic glioma -1.600 4.2e-02
Astrocytoma, Pilocytic -3.100 1.0e-10
Atopic dermatitis -1.400 6.7e-03
atypical teratoid / rhabdoid tumor -2.900 1.5e-09
ependymoma -1.500 8.4e-03
glioblastoma -2.100 5.3e-05
group 3 medulloblastoma -3.500 1.3e-05
medulloblastoma, large-cell -2.700 5.9e-04
oligodendroglioma -1.300 2.5e-05
primitive neuroectodermal tumor -2.800 4.9e-04
progressive supranuclear palsy -1.400 2.7e-02
psoriasis -2.300 1.9e-28
subependymal giant cell astrocytoma -2.456 4.4e-02

Gene RIF (1)

AA Sequence

MGIKTALPAAELGLYSLVLSGALAYAGRGLLEASQDGAHRKAFRESVRPGWEYIGRKMDVADFEWVMWFT      1 - 70
SFRNVIIFALSGHVLFAKLCTMVAPKLRSWMYAVYGALAVMGTMGPWYLLLLLGHCVGLYVASLLGQPWL     71 - 140
CLGLGLASLASFKMDPLISWQSGFVTGTFDLQEVLFHGGSSFTVLRCTSFALESCAHPDRHYSLADLLKY    141 - 210
NFYLPFFFFGPIMTFDRFHAQVSQVEPVRREGELWHIRAQAGLSVVAIMAVDIFFHFFYILTIPSDLKFA    211 - 280
NRLPDSALAGLAYSNLVYDWVKAAVLFGVVNTVACLDHLDPPQPPKCITALYVFAETHFDRGINDWLCKY    281 - 350
VYNHIGGEHSAVIPELAATVATFAITTLWLGPCDIVYLWSFLNCFGLNFELWMQKLAEWGPLARIEASLS    351 - 420
VQMSRRVRALFGAMNFWAIIMYNLVSLNSLKFTELVARRLLLTGFPQTTLSILFVTYCGVQLVKERERTL    421 - 490
ALEEEQKQDKEKPE                                                            491 - 504
//

Text Mined References (5)

PMID Year Title