Property Summary

NCBI Gene PubMed Count 24
PubMed Score 87.31
PubTator Score 47.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
cystic fibrosis 1670
Disease Target Count Z-score Confidence
Cancer 2346 3.579 1.8

Expression

Gene RIF (9)

PMID Text
25998175 Based upon ethnicity-stratified single-variant association analysis and trans-ethnic meta-analysis of 6201 participants of the Multi-Ethnic Study of Atherosclerosis, discovered 5 common and low-frequency variants: HGF missense polymorphism rs5745687 (p.E299K) and 4 variants (rs16844364, rs4690098, rs114303452, rs3748034) within or in proximity to HGFAC.[Meta-analysis]
20424473 Observational study of gene-disease association. (HuGE Navigator)
19456860 Results suggest that hepatocyte growth factor activator is a major serum activator of pro-macrophage-stimulating protein.
18691255 the activated form of HGFA is present at high levels in serum and bone marrow of myeloma patients, thus providing a necessary prerequisite for the activation of HGF.
18422749 Induction of hepatocyte growth factor activator gene expression under hypoxia activates the hepatocyte growth factor/c-Met system via hypoxia inducible factor-1 in pancreatic cancer.
18221492 KLK4 and KLK5 activate pro-HGFA.
16189274 HGF/MET signaling and aberrant HGF-activator expression is associated with diffuse large B-cell lymphoma
15172968 the HGF-activator has a role in multiple myeloma cells' catalysis of hepatocyte growth factor (HGF) activation
11013244 HAI-1 (serine peptidase inhibitor, Kunitz type 1) specifically traps active form of HGF activator on cellular surface and regulates HGF activation in pericellular microenvironment.

AA Sequence

MGRWAWVPSPWPPPGLGPFLLLLLLLLLLPRGFQPQPGGNRTESPEPNATATPAIPTILVTSVTSETPAT      1 - 70
SAPEAEGPQSGGLPPPPRAVPSSSSPQAQALTEDGRPCRFPFRYGGRMLHACTSEGSAHRKWCATTHNYD     71 - 140
RDRAWGYCVEATPPPGGPAALDPCASGPCLNGGSCSNTQDPQSYHCSCPRAFTGKDCGTEKCFDETRYEY    141 - 210
LEGGDRWARVRQGHVEQCECFGGRTWCEGTRHTACLSSPCLNGGTCHLIVATGTTVCACPPGFAGRLCNI    211 - 280
EPDERCFLGNGTGYRGVASTSASGLSCLAWNSDLLYQELHVDSVGAAALLGLGPHAYCRNPDNDERPWCY    281 - 350
VVKDSALSWEYCRLEACESLTRVQLSPDLLATLPEPASPGRQACGRRHKKRTFLRPRIIGGSSSLPGSHP    351 - 420
WLAAIYIGDSFCAGSLVHTCWVVSAAHCFSHSPPRDSVSVVLGQHFFNRTTDVTQTFGIEKYIPYTLYSV    421 - 490
FNPSDHDLVLIRLKKKGDRCATRSQFVQPICLPEPGSTFPAGHKCQIAGWGHLDENVSGYSSSLREALVP    491 - 560
LVADHKCSSPEVYGADISPNMLCAGYFDCKSDACQGDSGGPLACEKNGVAYLYGIISWGDGCGRLHKPGV    561 - 630
YTRVANYVDWINDRIRPPRRLVAPS                                                 631 - 655
//

Text Mined References (28)

PMID Year Title
25998175 2015 Trans-ethnic meta-analysis identifies common and rare variants associated with hepatocyte growth factor levels in the Multi-Ethnic Study of Atherosclerosis (MESA).
23969696 2013 Multiethnic meta-analysis of genome-wide association studies in >100 000 subjects identifies 23 fibrinogen-associated Loci but no strong evidence of a causal association between circulating fibrinogen and cardiovascular disease.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
19456860 2009 Hepatocyte growth factor activator is a serum activator of single-chain precursor macrophage-stimulating protein.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18691255 2008 Elevated serum concentrations of activated hepatocyte growth factor activator in patients with multiple myeloma.
18422749 2008 Induction of hepatocyte growth factor activator gene expression under hypoxia activates the hepatocyte growth factor/c-Met system via hypoxia inducible factor-1 in pancreatic cancer.
18221492 2008 Activation of hepatocyte growth factor activator zymogen (pro-HGFA) by human kallikrein 1-related peptidases.
18077410 2007 Structural insight into distinct mechanisms of protease inhibition by antibodies.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16189274 2006 Functional analysis of HGF/MET signaling and aberrant HGF-activator expression in diffuse large B-cell lymphoma.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15713485 2005 Conformational lability in serine protease active sites: structures of hepatocyte growth factor activator (HGFA) alone and with the inhibitory domain from HGFA inhibitor-1B.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15172968 2004 Multiple myeloma cells catalyze hepatocyte growth factor (HGF) activation by secreting the serine protease HGF-activator.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11201608 2000 Localization of hepatocyte growth factor activator inhibitor type 1 in Langhans' cells of human placenta.
11013244 2000 Hepatocyte growth factor activator inhibitor type 1 is a specific cell surface binding protein of hepatocyte growth factor activator (HGFA) and regulates HGFA activity in the pericellular microenvironment.
9874200 1998 Structural organization and chromosomal localization of the human hepatocyte growth factor activator gene--phylogenetic and functional relationship with blood coagulation factor XII, urokinase, and tissue-type plasminogen activator.
9346890 1997 Purification and cloning of hepatocyte growth factor activator inhibitor type 2, a Kunitz-type serine protease inhibitor.
9045658 1997 Hepatocyte growth factor activator inhibitor, a novel Kunitz-type serine protease inhibitor.
8631970 1996 Activation of hepatocyte growth factor in the injured tissues is mediated by hepatocyte growth factor activator.
8226803 1993 Activation of the zymogen of hepatocyte growth factor activator by thrombin.
7683665 1993 Molecular cloning and sequence analysis of the cDNA for a human serine protease reponsible for activation of hepatocyte growth factor. Structural similarity of the protease precursor to blood coagulation factor XII.
1838014 1991 Structure and function of hepatocyte growth factor.
1368819 1992 A novel protease obtained from FBS-containing culture supernatant, that processes single chain form hepatocyte growth factor to two chain form in serum-free culture.