Property Summary

NCBI Gene PubMed Count 6
PubMed Score 48.10
PubTator Score 564.93

Knowledge Summary


No data available


  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.138 8.0e-05
posterior fossa group A ependymoma 1.200 1.3e-04
group 3 medulloblastoma 1.700 2.8e-03
mucosa-associated lymphoid tissue lympho... -1.159 1.9e-02

Gene RIF (4)

24597873 Exome sequencing of two Chinese sisters with primary ovarian insufficiency and their parents identified a shared compound heterozygous mutation in a meiotic gene, HFM1, which encodes a protein necessary for homologous recombination of chromosomes.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17286053 hHFM1 is the evolutionally conserved putative human DNA helicase, which may function as a modulator for genome integrity in germ-line tissues.

AA Sequence

IRNSECKKEVDFSMYHPDDEADEMKSLLGIFDGIF                                      1401 - 1435

Text Mined References (7)

PMID Year Title
24597873 2014 Mutations in HFM1 in recessive primary ovarian insufficiency.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17286053 2006 HFM1, the human homologue of yeast Mer3, encodes a putative DNA helicase expressed specifically in germ-line cells.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.