Property Summary

NCBI Gene PubMed Count 19
PubMed Score 91.47
PubTator Score 57.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Protein-protein Interaction (3)

Gene RIF (3)

PMID Text
25217524 repression of TGFbeta signaling by Notch acting through HEYL may promote initiation of breast cancer
21454491 Repression of androgen receptor activity by HEYL, a third member of the Hairy/Enhancer-of-split-related family of Notch effectors.
21290414 In this study, we analyzed the effects of HESR1, -2, and -3 on DAT1 expression in human neuroblastoma SH-SY5Y cells

AA Sequence

MKRPKEPSGSDGESDGPIDVGQEGQLSQMARPLSTPSSSQMQARKKHRGIIEKRRRDRINSSLSELRRLV      1 - 70
PTAFEKQGSSKLEKAEVLQMTVDHLKMLHATGGTGFFDARALAVDFRSIGFRECLTEVIRYLGVLEGPSS     71 - 140
RADPVRIRLLSHLNSYAAEMEPSPTPTGPLAFPAWPWSFFHSCPGLPALSNQLAILGRVPSPVLPGVSSP    141 - 210
AYPIPALRTAPLRRATGIILPARRNVLPSRGASSTRRARPLERPATPVPVAPSSRAARSSHIAPLLQSSS    211 - 280
PTPPGPTGSAAYVAVPTPNSSSPGPAGRPAGAMLYHSWVSEITEIGAF                          281 - 328
//

Text Mined References (21)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25217524 2014 The Notch pathway inhibits TGF? signaling in breast cancer through HEYL-mediated crosstalk.
23222517 2012 Seventy-five genetic loci influencing the human red blood cell.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21454491 2011 Repression of androgen receptor activity by HEYL, a third member of the Hairy/Enhancer-of-split-related family of Notch effectors.
21290414 2011 Differential effects of the HESR/HEY transcription factor family on dopamine transporter reporter gene expression via variable number of tandem repeats.
17611704 2007 Integrative genomic analyses on HES/HEY family: Notch-independent HES1, HES3 transcription in undifferentiated ES cells, and Notch-dependent HES1, HES5, HEY1, HEY2, HEYL transcription in fetal tissues, adult tissues, or cancer.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16165016 2005 Hesr, a mediator of the Notch signaling, functions in heart and vessel development.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485867 2004 Hairy-related transcription factors inhibit GATA-dependent cardiac gene expression through a signal-responsive mechanism.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
12548545 2003 HES and HERP families: multiple effectors of the Notch signaling pathway.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11095750 2000 Members of the HRT family of basic helix-loop-helix proteins act as transcriptional repressors downstream of Notch signaling.
10964718 2000 Comparative analysis of the human and mouse Hey1 promoter: Hey genes are new Notch target genes.
10924525 2000 The basic helix-loop-helix transcription factors dHAND and eHAND exhibit dimerization characteristics that suggest complex regulation of function.
10860664 2000 Characterization of the human and mouse HEY1, HEY2, and HEYL genes: cloning, mapping, and mutation screening of a new bHLH gene family.
10415358 1999 Hey genes: a novel subfamily of hairy- and Enhancer of split related genes specifically expressed during mouse embryogenesis.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.