Property Summary

NCBI Gene PubMed Count 42
PubMed Score 240.91
PubTator Score 161.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytoma 1.200 5.5e-10
posterior fossa group B ependymoma 2.400 1.5e-10
glioblastoma 1.400 2.8e-03
intraductal papillary-mucinous carcinoma... -1.200 2.0e-03
interstitial cystitis 1.200 2.1e-03
adult high grade glioma 1.200 4.2e-03
pilocytic astrocytoma 2.800 3.8e-10
Breast cancer -3.200 7.0e-24
lung carcinoma 1.100 1.2e-06
ovarian cancer 1.600 1.7e-04

Protein-protein Interaction (5)

Gene RIF (20)

PMID Text
26729854 HEY2 CC genotype may be a favorable prognostic marker for BrS, protectively acting to prevent ventricular fibrillation presumably by regulating the repolarization current.
25832314 Individuals with HEY2 duplications should be screened for congenital heart defects.
25799559 bone morphogenic proteins within the serum of cell culture medium are potent inducers of endothelial Hey1 and Hey2 gene expression within the first few hours after medium change
25361534 Overexpression of HEY1 and HEY2 in esophageal squamous cell carcinoma (ESCC) is correlated to different indices of poor prognosis, and it is extrapolated that such overexpression is important in progression and development of ESCC tumorigenesis.
24366871 a new HRD1-associated membrane protein named HERP2, which is homologous to the previously identified HRD1 partner HERP1. Despite sequence homology, HERP2 is constitutively expressed in cells, whereas HERP1 is highly induced by ER stress.
24108462 Data indicate that culture abrogated differential gene expression in part due to gradual loss of canonical Notch activity and HEY2 expression.
23872634 Common variants at SCN5A-SCN10A and HEY2 are associated with Brugada syndrome, a rare disease with high risk of sudden cardiac death
23744056 Hey2 and COUP-TFII have an important role in arteriovenous differentiation of human endothelial cells.
22310065 Report down-regulation of Notch signaling components NOTCH3 and HEY2 in abdominal aortic aneurysms.
21362320 Through activating the Dll4-Notch-Hey2 signaling pathway, HGF indirectly promotes the proliferation and migration ability of cells, so that offspring artery branches are formed.
21290414 In this study, we analyzed the effects of HESR1, -2, and -3 on DAT1 expression in human neuroblastoma SH-SY5Y cells
18266235 The absence of mutations in NOTCH2 and Hey2 its downstream target in the heart does not exclude the possibility that other genes in this pathway might be implicated in the diverse phenotypes observed in Alagille syndrome
18239137 Present a novel mechanism by which a balance between Notch-1/-2/-4 signaling, via CBF-1, and HRT-1/-2 activity determines the expression of smooth muscle differentiation markers including actin.
16329098 This result suggests a possible role of HEY2 in the regulation of ventricular septation in humans.
16293227 CHF1/Hey2 may affect smooth-muscle cell phenotype through an important transcriptional mechanism
16151017 HERP1 may play a role in promoting the phenotypic modulation of vascular smooth muscle cells during vascular injury and atherosclerotic process by interfering with SRF binding to CArG-box
15680351 A similar gene in mouse regulates cardiovascular development
15643620 Observational study of gene-disease association. (HuGE Navigator)
15389319 To clarify the role of HEY2 in human CHD and AGS, we screened by direct sequencing 23 children with CHD and 38 patients diagnosed with AGS. Mutation of HEY2 is not a major contributing factor.
12535671 These results indicate that the molecular association between HES1-, HEY2- and SIRT1-related proteins is conserved among metazoans, from Drosophila to human, and suggest that the Sir2-bHLH interaction also plays important roles in human cells.

AA Sequence

MKRPCEETTSESDMDETIDVGSENNYSGQSTSSVIRLNSPTTTSQIMARKKRRGIIEKRRRDRINNSLSE      1 - 70
LRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQATGGKGYFDAHALAMDFMSIGFRECLTEVARYLSSV     71 - 140
EGLDSSDPLRVRLVSHLSTCATQREAAAMTSSMAHHHHPLHPHHWAAAFHHLPAALLQPNGLHASESTPC    141 - 210
RLSTTSEVPPAHGSALLTATFAHADSALRMPSTGSVAPCVPPLSTSLLSLSATVHAAAAAATAAAHSFPL    211 - 280
SFAGAFPMLPPNAAAAVAAATAISPPLSVSATSSPQQTSSGTNNKPYRPWGTEVGAF                 281 - 337
//

Text Mined References (42)

PMID Year Title
26729854 2016 Common Variant Near HEY2 Has a Protective Effect on Ventricular Fibrillation Occurrence in Brugada Syndrome by Regulating the Repolarization Current.
25832314 2015 Duplication of HEY2 in cardiac and neurologic development.
25799559 2015 Serum induces transcription of Hey1 and Hey2 genes by Alk1 but not Notch signaling in endothelial cells.
25416956 2014 A proteome-scale map of the human interactome network.
25361534 2015 Notch Signaling Target Genes are Directly Correlated to Esophageal Squamous Cell Carcinoma Tumorigenesis.
24366871 2014 Role of HERP and a HERP-related protein in HRD1-dependent protein degradation at the endoplasmic reticulum.
24108462 2013 Unraveling a novel transcription factor code determining the human arterial-specific endothelial cell signature.
23872634 2013 Common variants at SCN5A-SCN10A and HEY2 are associated with Brugada syndrome, a rare disease with high risk of sudden cardiac death.
23744056 2013 Impact of Hey2 and COUP-TFII on genes involved in arteriovenous differentiation in primary human arterial and venous endothelial cells.
23275563 2013 Development and application of a DNA microarray-based yeast two-hybrid system.
22310065 2012 Downregulation of transforming growth factor, beta receptor 2 and Notch signaling pathway in human abdominal aortic aneurysm.
21454491 2011 Repression of androgen receptor activity by HEYL, a third member of the Hairy/Enhancer-of-split-related family of Notch effectors.
21362320 2011 Effects of hepatocyte growth factor-mediated activation of Dll4-Notch-Hey2 signaling pathway.
21290414 2011 Differential effects of the HESR/HEY transcription factor family on dopamine transporter reporter gene expression via variable number of tandem repeats.
18266235 2008 Absence of NOTCH2 and Hey2 mutations in a familial Alagille syndrome case with a novel frameshift mutation in JAG1.
18239137 2008 Hairy-related transcription factors inhibit Notch-induced smooth muscle alpha-actin expression by interfering with Notch intracellular domain/CBF-1 complex interaction with the CBF-1-binding site.
17611704 2007 Integrative genomic analyses on HES/HEY family: Notch-independent HES1, HES3 transcription in undifferentiated ES cells, and Notch-dependent HES1, HES5, HEY1, HEY2, HEYL transcription in fetal tissues, adult tissues, or cancer.
16329098 2006 HEY2 mutations in malformed hearts.
16293227 2006 CHF1/Hey2 suppresses SM-MHC promoter activity through an interaction with GATA-6.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16165016 2005 Hesr, a mediator of the Notch signaling, functions in heart and vessel development.
16151017 2005 HERP1 inhibits myocardin-induced vascular smooth muscle cell differentiation by interfering with SRF binding to CArG box.
16043483 2005 MEF2-dependent recruitment of the HAND1 transcription factor results in synergistic activation of target promoters.
15821257 2005 Segmental expression of Notch and Hairy genes in nephrogenesis.
15680351 2005 Mouse hesr1 and hesr2 genes are redundantly required to mediate Notch signaling in the developing cardiovascular system.
15643620 2005 ZFPM2/FOG2 and HEY2 genes analysis in nonsyndromic tricuspid atresia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485867 2004 Hairy-related transcription factors inhibit GATA-dependent cardiac gene expression through a signal-responsive mechanism.
15389319 2004 Phenotypic variability in Hey2 -/- mice and absence of HEY2 mutations in patients with congenital heart defects or Alagille syndrome.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12548545 2003 HES and HERP families: multiple effectors of the Notch signaling pathway.
12535671 2003 Human Sir2-related protein SIRT1 associates with the bHLH repressors HES1 and HEY2 and is involved in HES1- and HEY2-mediated transcriptional repression.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12372254 2002 Tetralogy of fallot and other congenital heart defects in Hey2 mutant mice.
11486045 2001 HERP, a novel heterodimer partner of HES/E(spl) in Notch signaling.
11486044 2001 HERP, a new primary target of Notch regulated by ligand binding.
11095750 2000 Members of the HRT family of basic helix-loop-helix proteins act as transcriptional repressors downstream of Notch signaling.
10924525 2000 The basic helix-loop-helix transcription factors dHAND and eHAND exhibit dimerization characteristics that suggest complex regulation of function.
10860664 2000 Characterization of the human and mouse HEY1, HEY2, and HEYL genes: cloning, mapping, and mutation screening of a new bHLH gene family.
10710309 2000 gridlock, an HLH gene required for assembly of the aorta in zebrafish.
10692439 2000 Cardiovascular basic helix loop helix factor 1, a novel transcriptional repressor expressed preferentially in the developing and adult cardiovascular system.
10415358 1999 Hey genes: a novel subfamily of hairy- and Enhancer of split related genes specifically expressed during mouse embryogenesis.