Property Summary

NCBI Gene PubMed Count 53
PubMed Score 153.62
PubTator Score 152.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytoma 1.900 5.2e-24
glioblastoma 1.600 4.0e-07
oligodendroglioma 2.300 4.3e-03
nephrosclerosis 1.361 3.0e-04
malignant mesothelioma 2.300 5.0e-08
psoriasis -1.400 9.1e-03
atypical teratoid / rhabdoid tumor -1.200 1.7e-02
adrenocortical carcinoma 1.316 1.2e-02
tuberculosis -3.500 5.8e-08
interstitial cystitis -1.200 1.5e-03
lung adenocarcinoma -2.800 1.4e-16
pediatric high grade glioma 1.700 1.1e-05
pilocytic astrocytoma 1.600 4.1e-07
posterior fossa group B ependymoma 1.400 2.4e-05
Breast cancer -1.400 1.8e-02
ovarian cancer -1.500 4.6e-05

Gene RIF (30)

PMID Text
26068074 Expression of Hey1 induces translocation of FBXO45 into the nucleus.
25799559 bone morphogenic proteins within the serum of cell culture medium are potent inducers of endothelial Hey1 and Hey2 gene expression within the first few hours after medium change
25742474 MMP9 was a downstream effector of HEY1 that promotes the invasion of osteosarcoma cells. Knockdown of HEY1 decreased the expression of MMP9.
25361534 Overexpression of HEY1 and HEY2 in esophageal squamous cell carcinoma (ESCC) is correlated to different indices of poor prognosis, and it is extrapolated that such overexpression is important in progression and development of ESCC tumorigenesis.
24684754 In prostate tumors, the overexpression of PTOV1 was associated with decreased expression of HEY1 and HES1, and this correlation was significant in metastatic lesions.
24487962 PML degradation mechanism through Notch/Hey1-induced repression of the PML deubiquitinase USP11 involved in brain tumour pathogenesis
24366871 a new HRD1-associated membrane protein named HERP2, which is homologous to the previously identified HRD1 partner HERP1. Despite sequence homology, HERP2 is constitutively expressed in cells, whereas HERP1 is highly induced by ER stress.
24124145 The identification of HEY1-NCOA2 can be used as an auxiliary diagnostic tool to differentiate meningeal hemangiopericytoma from mesenchymal chondrosarcoma.
23900217 HEY1 was overexpressed in colorectal cancer, and correlated with perineural and vascular invasion and lymph node metastasis as well as poorer prognosis.
23379739 Data show that the periodontal ligament-derived mesenchymal stem cells (hPDLSCs) on a Jagged-1-modified surface had increased expression of Notch signaling target genes, Hes-1 and Hey-1, suggesting the involvement of Notch signaling in hPDLSCs.
23252872 The current study adds further support for the use of HEY1-NCOA2 fusion as a valid diagnostic marker for Mesenchymal chondrosarcoma
23226563 These data further support a central role for Notch signalling in pancreatic cancer and suggest that nuclear expression of Notch3 and its target gene, HEY-1, merit validation in biomarker panels for diagnosis, prognosis and treatment efficacy.
22036964 Data suggest that HEs-1/Hey-1 transcriptional modulation of insulin degrading enzyme may impact amyloid beta metabolism by providing a functional link between Notch signaling and the amyloidogenic pathway.
22034177 The novel HEY1-NCOA2 fusion appears to be the defining and diagnostic gene fusion in mesenchymal chondrosarcomas
21290414 In this study, we analyzed the effects of HESR1, -2, and -3 on DAT1 expression in human neuroblastoma SH-SY5Y cells
19917614 Hey1 inhibits myogenesis by associating with and repressing expression of key myogenic targets.
19857617 In transgenic mice Hey1 overexpression results in distinct progressive osteopenia and inhibition of osteoblasts ex vivo, an effect apparently dominant to a mild inhibition of osteoclasts.
19802006 Data show that HEY1 Leu94Met gene polymorphism converts HEY1 from an androgen receptor corepressor to an androgen receptor co-activator, and also abolishes HEY1-mediated activation of p53.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19369342 Hey1 represses the KSHV RTA promoter, and mSin3A interacts with Hey1 and that this interaction is abolished in the presence of RTA.
18986983 Hey1 and Runx2 were shown to act synergistically in BMP9-induced osteogenic differentiation, and Runx2 expression significantly decreased in the absence of Hey1, suggesting that Runx2 may function downstream of Hey1
18363832 Data imply a role for HEY1 in the progression of glioblastoma multiforme, and suggest that HEY1 may be a therapeutic target for glioblastoma patients.
18239137 Present a novel mechanism by which a balance between Notch-1/-2/-4 signaling, via CBF-1, and HRT-1/-2 activity determines the expression of smooth muscle differentiation markers including actin.
17496152 Declines in HEY1 are associated with pulmonary fibrosis and hypertension.
17028039 HESR1 seems to inhibit the vessel-promoting effects of VEGF, shift endothelial cells from a proliferative state to a quiescent state, and restore normal vessel structures.
15749835 Hesr1 down-regulates DAT1 gene expression with the 3' non-coding region, the negative regulations depend on bHLH and the Orange domain of the molecule, but not the YRPW motif.
15684393 Hey1 is excluded from the nucleus in most human prostate cancers, raising the possibility that an abnormal Hey1 subcellular distribution may have a role in the aberrant hormonal responses observed in prostate cancer.
15680351 A similar gene in mouse regulates cardiovascular development
15314183 These results define a novel regulatory pathway linking the transcription factors c-Jun, HERP2, and GATA-1.
12453432 HESR-1 may be involved in the phenotypic changes that characterize the progression from EC proliferation and migration to network formation and quiescence

AA Sequence

MKRAHPEYSSSDSELDETIEVEKESADENGNLSSALGSMSPTTSSQILARKRRRGIIEKRRRDRINNSLS      1 - 70
ELRRLVPSAFEKQGSAKLEKAEILQMTVDHLKMLHTAGGKGYFDAHALAMDYRSLGFRECLAEVARYLSI     71 - 140
IEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASP    141 - 210
TEPHHQGRLGSAHPEAPALRAPPSGSLGPVLPVVTSASKLSPPLLSSVASLSAFPFSFGSFHLLSPNALS    211 - 280
PSAPTQAANLGKPYRPWGTEIGAF                                                  281 - 304
//

Text Mined References (54)

PMID Year Title
26068074 2015 Hey bHLH Proteins Interact with a FBXO45 Containing SCF Ubiquitin Ligase Complex and Induce Its Translocation into the Nucleus.
25985737 2015 C8orf4 negatively regulates self-renewal of liver cancer stem cells via suppression of NOTCH2 signalling.
25799559 2015 Serum induces transcription of Hey1 and Hey2 genes by Alk1 but not Notch signaling in endothelial cells.
25742474 2015 Hairy/enhancer-of-split related with YRPW motif protein 1 promotes osteosarcoma metastasis via matrix metallopeptidase 9 expression.
25361534 2015 Notch Signaling Target Genes are Directly Correlated to Esophageal Squamous Cell Carcinoma Tumorigenesis.
24684754 2014 Prostate tumor OVerexpressed-1 (PTOV1) down-regulates HES1 and HEY1 notch targets genes and promotes prostate cancer progression.
24487962 2014 USP11 regulates PML stability to control Notch-induced malignancy in brain tumours.
24366871 2014 Role of HERP and a HERP-related protein in HRD1-dependent protein degradation at the endoplasmic reticulum.
24124145 2013 Are meningeal hemangiopericytoma and mesenchymal chondrosarcoma the same?: a study of HEY1-NCOA2 fusion.
23900217 2013 Notch-induced transcription factors are predictive of survival and 5-fluorouracil response in colorectal cancer patients.
23379739 2013 Notch signaling is involved in neurogenic commitment of human periodontal ligament-derived mesenchymal stem cells.
23252872 2012 Detection of HEY1-NCOA2 fusion by fluorescence in-situ hybridization in formalin-fixed paraffin-embedded tissues as a possible diagnostic tool for mesenchymal chondrosarcoma.
23226563 2012 Notch3 and HEY-1 as prognostic biomarkers in pancreatic adenocarcinoma.
22036964 2012 Notch signaling proteins HES-1 and Hey-1 bind to insulin degrading enzyme (IDE) proximal promoter and repress its transcription and activity: implications for cellular A? metabolism.
22034177 2012 Identification of a novel, recurrent HEY1-NCOA2 fusion in mesenchymal chondrosarcoma based on a genome-wide screen of exon-level expression data.
21454491 2011 Repression of androgen receptor activity by HEYL, a third member of the Hairy/Enhancer-of-split-related family of Notch effectors.
21290414 2011 Differential effects of the HESR/HEY transcription factor family on dopamine transporter reporter gene expression via variable number of tandem repeats.
19917614 2010 The Notch effector Hey1 associates with myogenic target genes to repress myogenesis.
19857617 2010 Ubiquitous overexpression of Hey1 transcription factor leads to osteopenia and chondrocyte hypertrophy in bone.
19802006 2010 HEY1 Leu94Met gene polymorphism dramatically modifies its biological functions.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19369342 2009 Kaposi's sarcoma-associated herpesvirus RTA promotes degradation of the Hey1 repressor protein through the ubiquitin proteasome pathway.
18986983 2009 Hey1 basic helix-loop-helix protein plays an important role in mediating BMP9-induced osteogenic differentiation of mesenchymal progenitor cells.
18363832 2009 A role for the transcription factor HEY1 in glioblastoma.
18239137 2008 Hairy-related transcription factors inhibit Notch-induced smooth muscle alpha-actin expression by interfering with Notch intracellular domain/CBF-1 complex interaction with the CBF-1-binding site.
17611704 2007 Integrative genomic analyses on HES/HEY family: Notch-independent HES1, HES3 transcription in undifferentiated ES cells, and Notch-dependent HES1, HES5, HEY1, HEY2, HEYL transcription in fetal tissues, adult tissues, or cancer.
17496152 2007 Genomic profile of matrix and vasculature remodeling in TGF-alpha induced pulmonary fibrosis.
17259303 2007 Hesr1 and Hesr2 regulate atrioventricular boundary formation in the developing heart through the repression of Tbx2.
17028039 2006 Protective effects of transcription factor HESR1 on retinal vasculature.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16165016 2005 Hesr, a mediator of the Notch signaling, functions in heart and vessel development.
16043483 2005 MEF2-dependent recruitment of the HAND1 transcription factor results in synergistic activation of target promoters.
15749835 2005 Identification and characterization of the Hesr1/Hey1 as a candidate trans-acting factor on gene expression through the 3' non-coding polymorphic region of the human dopamine transporter (DAT1) gene.
15684393 2005 Hey1, a mediator of notch signaling, is an androgen receptor corepressor.
15680351 2005 Mouse hesr1 and hesr2 genes are redundantly required to mediate Notch signaling in the developing cardiovascular system.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485867 2004 Hairy-related transcription factors inhibit GATA-dependent cardiac gene expression through a signal-responsive mechanism.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15314183 2004 Jun blockade of erythropoiesis: role for repression of GATA-1 by HERP2.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12548545 2003 HES and HERP families: multiple effectors of the Notch signaling pathway.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12453432 2002 Notch activation during endothelial cell network formation in vitro targets the basic HLH transcription factor HESR-1 and downregulates VEGFR-2/KDR expression.
11866539 2002 Identification of endothelial cell genes expressed in an in vitro model of angiogenesis: induction of ESM-1, (beta)ig-h3, and NrCAM.
11486045 2001 HERP, a novel heterodimer partner of HES/E(spl) in Notch signaling.
11486044 2001 HERP, a new primary target of Notch regulated by ligand binding.
11095750 2000 Members of the HRT family of basic helix-loop-helix proteins act as transcriptional repressors downstream of Notch signaling.
10964718 2000 Comparative analysis of the human and mouse Hey1 promoter: Hey genes are new Notch target genes.
10860664 2000 Characterization of the human and mouse HEY1, HEY2, and HEYL genes: cloning, mapping, and mutation screening of a new bHLH gene family.
10692439 2000 Cardiovascular basic helix loop helix factor 1, a novel transcriptional repressor expressed preferentially in the developing and adult cardiovascular system.
10415358 1999 Hey genes: a novel subfamily of hairy- and Enhancer of split related genes specifically expressed during mouse embryogenesis.
10403790 1999 Identification and expression of a novel family of bHLH cDNAs related to Drosophila hairy and enhancer of split.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.