1. Home
  2. Targets
  3. Protein HEXIM2

Tbio Protein HEXIM2

Transcriptional regulator which functions as a general RNA polymerase II transcription inhibitor. In cooperation with 7SK snRNA sequesters P-TEFb in a large inactive 7SK snRNP complex preventing RNA polymerase II phosphorylation and subsequent transcriptional elongation.

This gene encodes a member of the HEXIM family of proteins. This protein is a component of the 7SK small nuclear ribonucleoprotein. This protein has been found to negatively regulate the kinase activity of the cyclin-dependent kinase P-TEFb, which phosphorylates multiple target proteins to promote transcriptional elongation. This gene is located approximately 7 kb downstream from related family member HEXIM1 on chromosome 17. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2015]

 Comments

Property Summary

NCBI Gene PubMed Count 19
PubMed Score 1.68
PubTator Score 5.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7933 9.2e-07
group 3 medulloblastoma 2254 1.2e-02

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.593 9.2e-07
group 3 medulloblastoma 1.200 1.2e-02

Synonym

Accession Q96MH2 D3DX66
Symbols L3

Gene

HEXIM2

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 UniProt Keyword (8)

 GO Function (3)

 GO Component (3)

 GO Process (4)

 Compartment GO Term (28)

See all...

 HCA RNA Cell Line (56)

See all...

Protein-protein Interaction (17)

LARP7   CDK9   HAL   TCF12   USP9X   MEPCE   SURF2   CSNK2A2   MYCBP   CSNK2A1   BANP   CSNK2B   CCNT2   CCNT1   AHCYL2   AHCYL1   MINA  

Gene RIF (10)

PMID Text
23518577 A La-related protein, LARP7, is associated with P-TEFb, HEXIM1/2, MEPCE, and 7SK RNA in a large stable complex form. Knockdown of LARP7 decreases the steady-state level of 7SK, but increases free P-TEFb and enhances Tat-mediated transcription
22377309 A La-related protein, LARP7, is associated with P-TEFb, HEXIM1/2, MEPCE, and 7SK RNA in a large stable complex form. Knockdown of LARP7 decreases the steady-state level of 7SK, but increases free P-TEFb and enhances Tat-mediated transcription
22355797 A La-related protein, LARP7, is associated with P-TEFb, HEXIM1/2, MEPCE, and 7SK RNA in a large stable complex form. Knockdown of LARP7 decreases the steady-state level of 7SK, but increases free P-TEFb and enhances Tat-mediated transcription
19883659 The tripartite protein-RNA complex formation between Hexim, Cyclin T and 7SK snRNA, was analyzed.
18655042 A La-related protein, LARP7, is associated with P-TEFb, HEXIM1/2, MEPCE, and 7SK RNA in a large stable complex form. Knockdown of LARP7 decreases the steady-state level of 7SK, but increases free P-TEFb and enhances Tat-mediated transcription
18281698 A La-related protein, LARP7, is associated with P-TEFb, HEXIM1/2, MEPCE, and 7SK RNA in a large stable complex form. Knockdown of LARP7 decreases the steady-state level of 7SK, but increases free P-TEFb and enhances Tat-mediated transcription
15992410 A La-related protein, LARP7, is associated with P-TEFb, HEXIM1/2, MEPCE, and 7SK RNA in a large stable complex form. Knockdown of LARP7 decreases the steady-state level of 7SK, but increases free P-TEFb and enhances Tat-mediated transcription
15965233 Positive transcription elongation factor b regulates eukaryotic gene expression at the level of elongation and is controlled by the reversible association with HEXIM2.
15713662 utilization of HEXIM1 or HEXIM2 to bind and inhibit P-TEFb can be differentially regulated in vivo.
15713661 HEXIM2 can functionally and quantitatively compensate for the loss of HEXIM1

AA Sequence 

MMATPNQTACNAESPVALEEAKTSGAPGSPQTPPERHDSGGSLPLTPRMESHSEDEDLAGAVGGLGWNSR      1 - 70
SPRTQSPGGCSAEAVLARKKHRRRPSKRKRHWRPYLELSWAEKQQRDERQSQRASRVREEMFAKGQPVAP     71 - 140
YNTTQFLMNDRDPEEPNLDVPHGISHPGSSGESEAGDSDGRGRAHGEFQRKDFSETYERFHTESLQGRSK    141 - 210
QELVRDYLELEKRLSQAEEETRRLQQLQACTGQQSCRQVEELAAEVQRLRTENQRLRQENQMWNREGCRC    211 - 280
DEEPGT                                                                    281 - 286
//

Text Mined References (28)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24515107 2014 Release of positive transcription elongation factor b (P-TEFb) from 7SK small nuclear ribonucleoprotein (snRNP) activates hexamethylene bisacetamide-inducible protein (HEXIM1) transcription.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19883659 2010 Specificity of Hexim1 and Hexim2 complex formation with cyclin T1/T2, importin alpha and 7SK snRNA.
19430483 2009 Genome-wide association study identifies eight loci associated with blood pressure.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17709395 2007 The transcription-dependent dissociation of P-TEFb-HEXIM1-7SK RNA relies upon formation of hnRNP-7SK RNA complexes.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15994294 2005 Transcription-dependent association of multiple positive transcription elongation factor units to a HEXIM multimer.
15992410 2005 Inhibition of Tat activity by the HEXIM1 protein.
15965233 2005 Analysis of the large inactive P-TEFb complex indicates that it contains one 7SK molecule, a dimer of HEXIM1 or HEXIM2, and two P-TEFb molecules containing Cdk9 phosphorylated at threonine 186.
15713662 2005 HEXIM2, a HEXIM1-related protein, regulates positive transcription elongation factor b through association with 7SK.
15713661 2005 Compensatory contributions of HEXIM1 and HEXIM2 in maintaining the balance of active and inactive positive transcription elongation factor b complexes for control of transcription.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15334068 2004 Suppression subtractive hybridization and expression profiling identifies a unique set of genes overexpressed in non-small-cell lung cancer.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12832472 2003 MAQ1 and 7SK RNA interact with CDK9/cyclin T complexes in a transcription-dependent manner.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.