Property Summary

NCBI Gene PubMed Count 61
PubMed Score 64.65
PubTator Score 59.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
acute myeloid leukemia 1.300 5.0e-02
adrenocortical carcinoma -1.365 2.3e-04
adult high grade glioma -1.100 6.7e-04
group 3 medulloblastoma -1.200 6.0e-04
medulloblastoma, large-cell -1.900 3.6e-06
osteosarcoma -2.806 4.7e-07
ovarian cancer 1.300 2.3e-02

Gene RIF (71)

AA Sequence

MAEPFLSEYQHQPQTSNCTGAAAVQEELNPERPPGAEERVPEEDSRWQSRAFPQLGGRPGPEGEGSLESQ      1 - 70
PPPLQTQACPESSCLREGEKGQNGDDSSAGGDFPPPAEVEPTPEAELLAQPCHDSEASKLGAPAAGGEEE     71 - 140
WGQQQRQLGKKKHRRRPSKKKRHWKPYYKLTWEEKKKFDEKQSLRASRIRAEMFAKGQPVAPYNTTQFLM    141 - 210
DDHDQEEPDLKTGLYSKRAAAKSDDTSDDDFMEEGGEEDGGSDGMGGDGSEFLQRDFSETYERYHTESLQ    211 - 280
NMSKQELIKEYLELEKCLSRMEDENNRLRLESKRLGGDDARVRELELELDRLRAENLQLLTENELHRQQE    281 - 350
RAPLSKFGD                                                                 351 - 359
//

Text Mined References (74)

PMID Year Title