Property Summary

Ligand Count 1
NCBI Gene PubMed Count 94
PubMed Score 146.34
PubTator Score 161.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Acute kidney injury 70 0.0 0.0
Sandhoff disease 3 0.0 5.0
Disease Target Count Z-score Confidence
Gangliosidosis 20 6.553 3.3
Neurodegenerative disease 414 0.0 4.0

Expression

  Differential Expression (13)

Disease log2 FC p
acute myeloid leukemia -1.400 4.6e-02
Breast cancer 3.000 2.2e-02
dermatomyositis 1.400 2.0e-03
diabetes mellitus -1.300 1.7e-02
Duchenne muscular dystrophy 1.045 2.4e-08
esophageal adenocarcinoma 1.500 1.9e-02
glioblastoma 2.400 5.7e-05
juvenile dermatomyositis 1.373 6.7e-13
lung cancer -1.200 2.4e-03
medulloblastoma, large-cell -1.200 4.2e-05
Multiple myeloma 1.580 1.2e-04
ovarian cancer -2.500 1.1e-09
Waldenstrons macroglobulinemia 1.183 1.7e-03

Protein-protein Interaction (3)

Gene RIF (39)

AA Sequence

MELCGLGLPRPPMLLALLLATLLAAMLALLTQVALVVQVAEAARAPSVSAKPGPALWPLPLSVKMTPNLL      1 - 70
HLAPENFYISHSPNSTAGPSCTLLEEAFRRYHGYIFGFYKWHHEPAEFQAKTQVQQLLVSITLQSECDAF     71 - 140
PNISSDESYTLLVKEPVAVLKANRVWGALRGLETFSQLVYQDSYGTFTINESTIIDSPRFSHRGILIDTS    141 - 210
RHYLPVKIILKTLDAMAFNKFNVLHWHIVDDQSFPYQSITFPELSNKGSYSLSHVYTPNDVRMVIEYARL    211 - 280
RGIRVLPEFDTPGHTLSWGKGQKDLLTPCYSRQNKLDSFGPINPTLNTTYSFLTTFFKEISEVFPDQFIH    281 - 350
LGGDEVEFKCWESNPKIQDFMRQKGFGTDFKKLESFYIQKVLDIIATINKGSIVWQEVFDDKAKLAPGTI    351 - 420
VEVWKDSAYPEELSRVTASGFPVILSAPWYLDLISYGQDWRKYYKVEPLDFGGTQKQKQLFIGGEACLWG    421 - 490
EYVDATNLTPRLWPRASAVGERLWSSKDVRDMDDAYDRLTRHRCRMVERGIAAQPLYAGYCNHENM        491 - 556
//

Text Mined References (99)

PMID Year Title