Property Summary

NCBI Gene PubMed Count 21
PubMed Score 88.81
PubTator Score 45.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell -1.200 6.9e-04
group 4 medulloblastoma -1.100 5.4e-03

 GO Component (1)

Gene RIF (15)

PMID Text
26342546 that suppression of the HES5 leading to inhibition of proliferation may be one of the mechanisms against Hepatocellular carcinoma
25560400 HES5 silencing is an early and recurrent change in prostate tumourigenesis
24548083 these data identify HES5 as a key mediator of the Wnt-3a proneurogenic effect occurring independently of the classical Wnt/beta-catenin signaling cascade thus further deciphering crosstalk mechanisms of Wnt and Notch signaling pathways regulating cell fate
23776410 the downstream Notch signalling effector HES5 directly represses transcription of the E3 ligase Fbw7beta.
23637910 Notch3 and Hes5 are hypermethylated in human B cell acute lymphoblastic leukemia (ALL).
21495212 Hes5 overactivation is associated with cell differentiation, thereby resulting in uterine carcinogenesis.
21238798 In this study, HES 5 transcription factor was detected in the lining epithelium of human periapical cysts with limited inflammation, showing Notch pathway activation in those cells.
20091184 The expression of HES5 in adenocarcinoma was significantly higher than those in adenoma and normal control
18524252 regulates brain development process.[review]
18354251 Data show that HES5 are abundantly expressed in osteoarthritis.
17388915 expression significantly higher in squamous cervical carcinoma than in CIN as well as higher in CIN than normal cervical epithelia
17093926 Human HES5 gene is coupled to the Notch receptor family and expression of Notch markers (including HES5) decreases during cartilage differentiation.
17072841 The HLH gene HES5 on the other hand was only detected in chondrocytes.
16365048 Notch protein binding to Hes5-GFP is extinguished fast and recovered slowly, whereas Hes1-GFP is inhibited late and recovered quickly
16214363 For marking and purifying neural stem cells to ascertain whether differences exist, we generated transgenic mice using promoters from Hes genes (pHes1 or pHes5) to drive expression of destabilized enhanced green fluorescent protein.

AA Sequence

MAPSTVAVELLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLK      1 - 70
HSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQRPPAAPAAPAKEPKAPGAAP     71 - 140
PPALSAKATAAAAAAHQPACGLWRPW                                                141 - 166
//

Text Mined References (21)

PMID Year Title
26342546 2015 HES5 promotes cell proliferation and invasion through activation of STAT3 and predicts poor survival in hepatocellular carcinoma.
25560400 2015 HES5 silencing is an early and recurrent change in prostate tumourigenesis.
24548083 2014 HES5 is a key mediator of Wnt-3a-induced neuronal differentiation.
23776410 2013 Fbw7 repression by hes5 creates a feedback loop that modulates Notch-mediated intestinal and neural stem cell fate decisions.
23637910 2013 Epigenetic inactivation of Notch-Hes pathway in human B-cell acute lymphoblastic leukemia.
21495212 2010 Hes1/Hes5 gene inhibits differentiation via down-regulating Hash1 and promotes proliferation in cervical carcinoma cells.
21238798 2011 Immunohistochemical expression of Notch signaling in the lining epithelium of periapical cysts.
20091184 2010 The expressions of bHLH gene HES1 and HES5 in advanced ovarian serous adenocarcinomas and their prognostic significance: a retrospective clinical study.
19855400 2009 Notch3 signaling promotes the development of pulmonary arterial hypertension.
19682396 2009 Notch signaling is required for maintaining stem-cell features of neuroprogenitor cells derived from human embryonic stem cells.
18524252 2008 [Transcription factor network that regulates brain development].
18354251 2008 Notch1, Jagged1, and HES5 are abundantly expressed in osteoarthritis.
17849174 2008 Notch activation promotes cell proliferation and the formation of neural stem cell-like colonies in human glioma cells.
17611704 2007 Integrative genomic analyses on HES/HEY family: Notch-independent HES1, HES3 transcription in undifferentiated ES cells, and Notch-dependent HES1, HES5, HEY1, HEY2, HEYL transcription in fetal tissues, adult tissues, or cancer.
17388915 Expression of differentiation associated protein Hes1 and Hes5 in cervical squamous carcinoma and its precursors.
17093926 2007 Notch and HES5 are regulated during human cartilage differentiation.
17072841 2007 Differentiation of human mesenchymal stem cells and articular chondrocytes: analysis of chondrogenic potential and expression pattern of differentiation-related transcription factors.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15254753 2004 Identification and characterization of human HES2, HES3, and HES5 genes in silico.
15156153 2004 Hes binding to STAT3 mediates crosstalk between Notch and JAK-STAT signalling.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.