Property Summary

NCBI Gene PubMed Count 45
PubMed Score 66.30
PubTator Score 155.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytoma 1.100 4.1e-03
glioblastoma 1.500 5.9e-03
periodontitis 1.100 8.4e-22
intraductal papillary-mucinous carcinoma... -1.300 7.7e-03
intraductal papillary-mucinous neoplasm ... -1.300 3.7e-03
colon cancer -1.500 4.3e-02
lung cancer -1.600 6.7e-05
non primary Sjogren syndrome sicca 1.500 2.7e-02
ovarian cancer -2.100 1.2e-08

 GO Function (1)

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (21)

PMID Text
26823705 HERPUD1 SNPs are highly associated with polypoidal choroidal vasculopathy.
26616647 concluded that the HERPUD1-mediated cytoprotective effect against oxidative stress depends on the ITPR and Ca(2+) transfer from the endoplasmic reticulum to mitochondria
25637874 The results indicate that Nrf1 is a transcriptional activator of Herpud1 expression during ER stress, and they suggest Nrf1 is a key player in the regulation of the ER stress response in cells.
24120520 Herp operates as a relevant factor in the defense against glucose starvation by modulating autophagy levels.
23372434 Together with histological grade, increased co-expression of MIF and MMP9 in tumor might be a valuable predictor for recurrence, especially for benign meningiomas
21149444 binding of Herp to Hrd1-containing ERAD complexes positively regulates the ubiquitylation activity of these complexes, thus permitting survival of the cell during ER stress.
20604806 The results suggest that ERAD molecule Herp may delay the degradation of cytosolic proteins at the ubiquitination step.
20147634 Herp mimics structural determinants of DNA immunologically and can be immunogenic in vivo. Thus, Herp represents a candidate autoantigen for anti-DNA antibodies.
20054003 Data show that that 4-trifluoromethyl-celecoxib can inhibit secretion but not transcription of IL-12 (p35/p40) and IL-23 (p40/p19 heterodimers), and that this is associated with HERP function in the endoplasmic reticulum.
19788048 Herp may play a role in the initiation of the well-known inflammation-like changes in Parkinson disease substantia nigra and serve as a molecular link between degeneration and neuroinflammation in Parkinson disease
19447887 the underlying molecular mechanism(s) whereby Herp counteracts Ca(2+) disturbances will provide insights into the molecular cascade of cell death in dopaminergic neurons
19251110 Type II alcoholic patients had a statistically significant higher expression of Herp mRNA due to upregulation of the expression of this neuroprotective cell non-chaperone by toxic effects of ethanol.
18307982 Our data suggest that Herp binding to ubiquilin proteins plays an important role in the ERAD pathway and that ubiquilins are specifically involved in degradation of only a subset of ubiquitinated targets, including Herp-dependent ERAD substrates.
18042451 Herp is in a complex with ubiquitinated proteins and with the 26S proteasome, suggesting that it plays a role in linking substrates with the proteasome.
17020760 We identified the transcription factor binding site AARE (amino acid response element) by mutational analysis involved in Herp induction in SH-SY5Y cells, and the more significant role of the CREB binding site compared to AARE in HEK 293T cells.
17020760 Expression of Herp protein is up-regulated in response to ER stress, including homocysteine.
16940180 Results report the identification of Herp, a gene involved in ER stress-associated protein degradation (ERAD), as a direct target of Luman.
14550564 The ubiquitin-like domain of Herp most likely plays a role in the regulation of the intracellular level of Herp under ER stress
12370023 may associate through its ubiquitin-like domain with the 26S proteasome, in this way connecting the protein degradation machinery to the ER membrane and resulting in an efficient ERAD
12153396 upregulation by Wnt-1
11799129 enhances presnilin-mediated generation of amyloid beta protein

AA Sequence

MESETEPEPVTLLVKSPNQRHRDLELSGDRGWSVGHLKAHLSRVYPERPRPEDQRLIYSGKLLLDHQCLR      1 - 70
DLLPKQEKRHVLHLVCNVKSPSKMPEINAKVAESTEEPAGSNRGQYPEDSSSDGLRQREVLRNLSSPGWE     71 - 140
NISRPEAAQQAFQGLGPGFSGYTPYGWLQLSWFQQIYARQYYMQYLAATAASGAFVPPPSAQEIPVVSAP    141 - 210
APAPIHNQFPAENQPANQNAAPQVVVNPGANQNLRMNAQGGPIVEEDDEINRDWLDWTYSAATFSVFLSI    211 - 280
LYFYSSLSRFLMVMGATVVMYLHHVGWFPFRPRPVQNFPNDGPPPDVVNQDPNNNLQEGTDPETEDPNHL    281 - 350
PPDRDVLDGEQTSPSFMSTAWLVFKTFFASLLPEGPPAIAN                                 351 - 391
//

Text Mined References (49)

PMID Year Title
26823705 2015 Evidence of a novel gene HERPUD1 in polypoidal choroidal vasculopathy.
26616647 2016 HERPUD1 protects against oxidative stress-induced apoptosis through downregulation of the inositol 1,4,5-trisphosphate receptor.
25660456 2015 Identification of ERAD components essential for dislocation of the null Hong Kong variant of ?-1-antitrypsin (NHK).
25637874 2015 Induction of Herpud1 expression by ER stress is regulated by Nrf1.
24886709 2014 Amerindian-specific regions under positive selection harbour new lipid variants in Latinos.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24120520 2013 Herp depletion protects from protein aggregation by up-regulating autophagy.
23505323 2013 Genomic study in Mexicans identifies a new locus for triglycerides and refines European lipid loci.
23372434 2013 Increased co-expression of macrophage migration inhibitory factor and matrix metalloproteinase 9 is associated with tumor recurrence of meningioma.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22045699 2012 The homocysteine-inducible endoplasmic reticulum (ER) stress protein Herp counteracts mutant ?-synuclein-induced ER stress via the homeostatic regulation of ER-resident calcium release channel proteins.
21269460 2011 Initial characterization of the human central proteome.
21149444 2011 Herp regulates Hrd1-mediated ubiquitylation in a ubiquitin-like domain-dependent manner.
20838585 2010 Longitudinal genome-wide association of cardiovascular disease risk factors in the Bogalusa heart study.
20694148 2010 A genome-wide association study of the metabolic syndrome in Indian Asian men.
20604806 2010 Deletion of Herp facilitates degradation of cytosolic proteins.
20147634 2010 The endoplasmic reticulum stress-inducible protein, Herp, is a potential triggering antigen for anti-DNA response.
20054003 2010 Inhibition of secretion of interleukin (IL)-12/IL-23 family cytokines by 4-trifluoromethyl-celecoxib is coupled to degradation via the endoplasmic reticulum stress protein HERP.
20031564 2009 Polymorphism in the CETP gene region, HDL cholesterol, and risk of future myocardial infarction: Genomewide analysis among 18 245 initially healthy women from the Women's Genome Health Study.
19946888 2010 Defining the membrane proteome of NK cells.
19788048 Homocysteine-induced endoplasmic reticulum protein (herp) is up-regulated in parkinsonian substantia nigra and present in the core of Lewy bodies.
19447887 2009 The homocysteine-inducible endoplasmic reticulum stress protein counteracts calcium store depletion and induction of CCAAT enhancer-binding protein homologous protein in a neurotoxin model of Parkinson disease.
19251110 2009 Herp mRNA expression in patients classified according to Lesch's typology.
18656546 2008 Ubxd1 is a novel co-factor of the human p97 ATPase.
18307982 2008 Herp enhances ER-associated protein degradation by recruiting ubiquilins.
18042451 2007 Characterization of an ERAD pathway for nonglycosylated BiP substrates, which require Herp.
17420289 2007 The ubiquitin E3 ligase POSH regulates calcium homeostasis through spatial control of Herp.
17020760 2006 Homocysteine regulates expression of Herp by DNA methylation involving the AARE and CREB binding sites.
16940180 2006 Luman/CREB3 induces transcription of the endoplasmic reticulum (ER) stress response protein Herp through an ER stress response element.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16289116 2005 The ubiquitin-domain protein HERP forms a complex with components of the endoplasmic reticulum associated degradation pathway.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15147274 2004 Role of Herp in the endoplasmic reticulum stress response.
15102845 2004 Herp stabilizes neuronal Ca2+ homeostasis and mitochondrial function during endoplasmic reticulum stress.
14550564 2003 The ubiquitin-like domain of Herp is involved in Herp degradation, but not necessary for its enhancement of amyloid beta-protein generation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12370023 2001 Mif1: a missing link between the unfolded protein response pathway and ER-associated protein degradation?
12153396 2002 Murine Nr4a1 and Herpud1 are up-regulated by Wnt-1, but the homologous human genes are independent from beta-catenin activation.
11799129 2002 Endoplasmic reticulum stress-inducible protein, Herp, enhances presenilin-mediated generation of amyloid beta-protein.
11112790 2001 Identification of ERSE-II, a new cis-acting element responsible for the ATF6-dependent mammalian unfolded protein response.
10922362 2000 Herp, a new ubiquitin-like membrane protein induced by endoplasmic reticulum stress.
10708769 2000 The novel MMS-inducible gene Mif1/KIAA0025 is a target of the unfolded protein response pathway.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7584026 1994 Prediction of the coding sequences of unidentified human genes. I. The coding sequences of 40 new genes (KIAA0001-KIAA0040) deduced by analysis of randomly sampled cDNA clones from human immature myeloid cell line KG-1.