Property Summary

NCBI Gene PubMed Count 23
PubMed Score 41.34
PubTator Score 36.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
systemic lupus erythematosus 1.700 4.9e-04
Multiple myeloma 2.057 1.4e-03
malignant mesothelioma 4.700 1.1e-09
cutaneous lupus erythematosus 3.100 2.7e-04
glioblastoma 1.600 6.2e-04
ependymoma 1.500 1.8e-05
cystic fibrosis 2.379 4.5e-06
medulloblastoma, large-cell -1.400 5.1e-05
juvenile dermatomyositis 2.926 7.5e-17
intraductal papillary-mucinous carcinoma... -1.500 8.9e-03
lung cancer -3.100 1.6e-05
diabetes mellitus 2.500 1.1e-03
Multiple Sclerosis 2.800 4.0e-03
pediatric high grade glioma 1.500 7.1e-04
group 4 medulloblastoma -1.200 5.7e-03
pilocytic astrocytoma 1.600 7.6e-05
primary Sjogren syndrome 1.700 2.7e-04
subependymal giant cell astrocytoma 2.522 2.4e-03
lung carcinoma -1.700 1.1e-15
ovarian cancer -2.000 5.9e-04
pituitary cancer -2.800 7.2e-07
dermatomyositis 1.600 3.0e-02

Gene RIF (18)

PMID Text
26653219 HERC5 plays a crucial role in HCC immune evasion and has clinical relevance as a reproducible prognostic marker for risk of tumor recurrence and survival in patients.
26361997 The inhibitory effect of ISG15 on HCV RNA replication does not require its conjugation to substrates by HERC5.
26355087 vIRF1 association with HERC5 altered ISG15 modification of cellular proteins, and knockdown of ISG15 augmented reactivation of KSHV from latency.
26116899 HIV-1 Vpr upregulates the gene expression of HERC5 in human monocyte-derived dendritic cells
25353388 Results show that HERC5 gene may be involved in regulating the spread of non-small cell lung cancer tumors where the methylation of its promoter is correlated with number increase of disseminated tumor cells and metastases as well as survival decreased.
25010285 HIV-1 Vpr upregulates the gene expression of HERC5 in human monocyte-derived dendritic cells
24742225 The study reports on the NMR solution structure of a G-quadruplex formed by the CEB1 DNA G-rich fragment d(AGGGGGGAGGGAGGGTGG), harboring several G-tracts including one with six continuous guanines.
24693865 Authors identified a second distinct mechanism by which HERC5 inhibits HIV-1 replication and demonstrate that HERC5 is evolving under strong positive selection.
24693865 HIV-1 Vpr upregulates the gene expression of HERC5 in human monocyte-derived dendritic cells
23538710 Data indicate that income was inversely related to smoking behavior, and paternally derived CEB1 mutations were dose dependently increased when the father smoked in the 6 mo before pregnancy, 0.21 vs. 0.05 in smoking and nonsmoking fathers, respectively.
22405323 HIV-1 Vpr upregulates the gene expression of HERC5 in human monocyte-derived dendritic cells
22093708 The E3 ligase activity of HERC5 was required for blocking HIV-1 Gag particle production and correlated with the post-translational modification of Gag with ISG15.
22093708 HIV-1 Vpr upregulates the gene expression of HERC5 in human monocyte-derived dendritic cells
20308324 This study characterizes HERC5 as a positive regulator of innate antiviral responses, and show that it sustains IRF3 activation via a novel posttranslational modification, ISG15-ylation.
17471231 Overexpression of cyclin E is associated with neuroendocrine lung tumors
16884686 these results suggest that Herc5 functions as a general E3 ligase for protein ISGylation.
16815975 HERC5/Ceb1 is involved in the conjugation of ISG15 to cellular proteins.
15331633 Data show that HERC5, a functionally active HECT ubiquitin ligase, exhibits a tightly controlled cytosolic level under inflammatory conditions in endothelial cells.

AA Sequence

MERRSRRKSRRNGRSTAGKAAATQPAKSPGAQLWLFPSAAGLHRALLRRVEVTRQLCCSPGRLAVLERGG      1 - 70
AGVQVHQLLAGSGGARTPKCIKLGKNMKIHSVDQGAEHMLILSSDGKPFEYDNYSMKHLRFESILQEKKI     71 - 140
IQITCGDYHSLALSKGGELFAWGQNLHGQLGVGRKFPSTTTPQIVEHLAGVPLAQISAGEAHSMALSMSG    141 - 210
NIYSWGKNECGQLGLGHTESKDDPSLIEGLDNQKVEFVACGGSHSALLTQDGLLFTFGAGKHGQLGHNST    211 - 280
QNELRPCLVAELVGYRVTQIACGRWHTLAYVSDLGKVFSFGSGKDGQLGNGGTRDQLMPLPVKVSSSEEL    281 - 350
KLESHTSEKELIMIAGGNQSILLWIKKENSYVNLKRTIPTLNEGTVKRWIADVETKRWQSTKREIQEIFS    351 - 420
SPACLTGSFLRKRRTTEMMPVYLDLNKARNIFKELTQKDWITNMITTCLKDNLLKRLPFHSPPQEALEIF    421 - 490
FLLPECPMMHISNNWESLVVPFAKVVCKMSDQSSLVLEEYWATLQESTFSKLVQMFKTAVICQLDYWDES    491 - 560
AEENGNVQALLEMLKKLHRVNQVKCQLPESIFQVDELLHRLNFFVEVCRRYLWKMTVDASENVQCCVIFS    561 - 630
HFPFIFNNLSKIKLLHTDTLLKIESKKHKAYLRSAAIEEERESEFALRPTFDLTVRRNHLIEDVLNQLSQ    631 - 700
FENEDLRKELWVSFSGEIGYDLGGVKKEFFYCLFAEMIQPEYGMFMYPEGASCMWFPVKPKFEKKRYFFF    701 - 770
GVLCGLSLFNCNVANLPFPLALFKKLLDQMPSLEDLKELSPDLGKNLQTLLDDEGDNFEEVFYIHFNVHW    771 - 840
DRNDTNLIPNGSSITVNQTNKRDYVSKYINYIFNDSVKAVYEEFRRGFYKMCDEDIIKLFHPEELKDVIV    841 - 910
GNTDYDWKTFEKNARYEPGYNSSHPTIVMFWKAFHKLTLEEKKKFLVFLTGTDRLQMKDLNNMKITFCCP    911 - 980
ESWNERDPIRALTCFSVLFLPKYSTMETVEEALQEAINNNRGFG                              981 - 1024
//

Text Mined References (28)

PMID Year Title
26653219 2015 HERC5 is a prognostic biomarker for post-liver transplant recurrent human hepatocellular carcinoma.
26361997 2015 Inhibition of hepatitis C virus RNA replication by ISG15 does not require its conjugation to protein substrates by the HERC5 E3 ligase.
26355087 2015 Kaposi's Sarcoma-Associated Herpesvirus Viral Interferon Regulatory Factor 1 Interacts with a Member of the Interferon-Stimulated Gene 15 Pathway.
25353388 2015 Identification of HERC5 and its potential role in NSCLC progression.
24742225 2014 Structure and conformational dynamics of a stacked dimeric G-quadruplex formed by the human CEB1 minisatellite.
24693865 2014 Interferon-induced HERC5 is evolving under positive selection and inhibits HIV-1 particle production by a novel mechanism targeting Rev/RRE-dependent RNA nuclear export.
23538710 2013 Paternal lifestyle as a potential source of germline mutations transmitted to offspring.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22424883 2012 Genome-wide association study of lung function decline in adults with and without asthma.
22093708 2011 Human HERC5 restricts an early stage of HIV-1 assembly by a mechanism correlating with the ISGylation of Gag.
20542004 2010 The ISG15 conjugation system broadly targets newly synthesized proteins: implications for the antiviral function of ISG15.
20385878 2010 Herc5 attenuates influenza A virus by catalyzing ISGylation of viral NS1 protein.
20308324 2010 Positive regulation of interferon regulatory factor 3 activation by Herc5 via ISG15 modification.
20133869 2010 ISG15 conjugation system targets the viral NS1 protein in influenza A virus-infected cells.
19028597 2009 Maturation of human dendritic cells is accompanied by functional remodelling of the ubiquitin-proteasome system.
18057259 2008 Negative feedback regulation of RIG-I-mediated antiviral signaling by interferon-induced ISG15 conjugation.
17471231 2007 E2F-1, Skp2 and cyclin E oncoproteins are upregulated and directly correlated in high-grade neuroendocrine lung tumors.
16884686 2006 Identification and Herc5-mediated ISGylation of novel target proteins.
16815975 2006 HERC5 is an IFN-induced HECT-type E3 protein ligase that mediates type I IFN-induced ISGylation of protein targets.
16407192 2006 Herc5, an interferon-induced HECT E3 enzyme, is required for conjugation of ISG15 in human cells.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15676274 2005 The human HERC family of ubiquitin ligases: novel members, genomic organization, expression profiling, and evolutionary aspects.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15331633 2004 HERC5, a HECT E3 ubiquitin ligase tightly regulated in LPS activated endothelial cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11752456 2001 Insight into hepatocellular carcinogenesis at transcriptome level by comparing gene expression profiles of hepatocellular carcinoma with those of corresponding noncancerous liver.
10581175 1999 A novel human gene encoding HECT domain and RCC1-like repeats interacts with cyclins and is potentially regulated by the tumor suppressor proteins.