Property Summary

NCBI Gene PubMed Count 62
PubMed Score 17.07
PubTator Score 49.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.733 5.0e-05
glioblastoma -1.300 1.5e-04
Amyotrophic Lateral Sclerosis 1.043 1.2e-05
Pick disease -1.200 4.4e-04
ovarian cancer 1.900 5.3e-04

Gene RIF (47)

PMID Text
26436293 Ubiquitin-dependent NCOA4 turnover is promoted by excess iron and involves an iron-dependent interaction between NCOA4 and the HERC2 ubiquitin ligase.
25305019 Data show that histone H2A deubiquitinase USP16 interacts with E3 ubiquitin-protein ligase HERC2, negatively regulates DNA damage-induced ubiquitin foci formation, and is required for termination of the ubiquitin signal.
24855649 identified HERC2, a HECT domain-containing E3 ligase, as being responsible for polyubiquitination of USP33.
24778179 results thus suggest that HERC2 regulates the basal turnover of FBXL5, and that this ubiquitin-dependent degradation pathway contributes to the control of mammalian iron metabolism
24722987 Results identify HERC2 as a regulator of p53 signaling.
23601698 given a particular HERC2/OCA2 genotype, males are more prone to have lighter eye colors than predicted by their genotypes, while females tend to have darker eye colors than predicted
23243086 Studied an autosomal-recessive neurodevelopmental disorder with some phenotypic similarities to Angelman syndrome, found among the Old Order Amish. Our molecular investigation identified a mutation in HERC2 associated with the disease phenotype.
23178497 ATR-mediated phosphorylation induces XPA stabilization by antagonizing HERC2-catalyzed XPA ubiquitination.
23065719 Pathogenic changes in HERC2 are associated with nonsyndromic intellectual disability, autism, and gait disturbance.
22508508 In response to double-strand breaks, both HERC2 and RNF168 were specifically modified with SUMO1 at double-strand break sites in a manner dependent on the SUMO E3 ligase PIAS4.
22261722 the NEURL4-HERC2 complex participates in the ubiquitin-dependent regulation of centrosome architecture
22234890 HERC2 rs12913832 region functions as an enhancer regulating OCA2 transcription.
22190034 HIV-1 PR is identified to have a physical interaction with hect domain and RLD 2 (HERC2) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22124266 we found somatic mutations of HERC2, HERC3, TRIP12, UBE2Q1 and UBE4B genes in gastric carcinoma and colorectal carcinomas with microsatellite instability
21775519 These results suggest that HERC2 regulates DNA replication progression and origin firing by facilitating MCM2 phosphorylation.
21493713 HERC2 acts as a regulator of E6AP.
21197618 Data show that Mc1R, HERC2, IRF4, TYR and EXOC2 are ranked highest in hair color prediction analysis.
20886065 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20631078 Findings identify a function for HERC2 in regulating BRCA1 stability in opposition to BARD1. The HERC2 expression in breast epithelial cells and breast carcinomas suggests that this mechanism may play a role in breast carcinogenesis.
20629734 role in pigmentation characteristics in Spanish population
20629734 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20616560 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20585627 Observational study of gene-disease association. (HuGE Navigator)
20457063 ). Sequence variations in rs11636232 and rs7170852 in HERC2, rs1800407 in OCA2 and rs16891982 in MATP showed additional association with eye colours
20457063 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20304803 The circadian oscillation of XPA is achieved both by regulation of transcription by the core circadian clock proteins including cryptochrome and by regulation at the posttranslational level by the HERC2 ubiquitin ligase.
20176734 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19472299 Two single nucleotide polymorphisms found in intron 86 (rs12913832) and the 3' UTR region (rs1129038) of the HERC2 gene.
19472299 Observational study of gene-disease association. (HuGE Navigator)
19422935 Observational study of gene-disease association. (HuGE Navigator)
19208107 Results confirmed the association of HERC2 rs12913832 with eye colour and showed that this SNP is also significantly associated with skin and hair colouration.
19208107 Observational study of gene-disease association. (HuGE Navigator)
19174780 Observational study of gene-disease association. (HuGE Navigator)
19068216 Observational study of gene-disease association. (HuGE Navigator)
18528436 OCA2 and HERC2 have roles in hair color in Australian adolescents
18528436 Observational study of gene-disease association. (HuGE Navigator)
18483556 Genome-wide association study of gene-disease association. (HuGE Navigator)
18438405 Single nucleotide polymorphism in HERC2 gene is associated with ulcerative colitis
18438405 Observational study of gene-disease association. (HuGE Navigator)
18252222 Observational study of gene-disease association. (HuGE Navigator)
18252222 A single SNP in an evolutionary conserved region within intron 86 of the HERC2 gene determines human blue-brown eye color.
18252221 Genome-wide association study of gene-disease association. (HuGE Navigator)
18252221 We suggest that genetic variants regulating expression of the OCA2 gene exist in the HERC2 gene or, alternatively, within the 11.7 kb of sequence between OCA2 and HERC2, and that most iris color variation in Europeans is explained by those two genes.
18172690 Blue eye color in humans may be caused by a perfectly associated founder mutation in a regulatory element located within the HERC2 gene inhibiting OCA2 expression

AA Sequence

MPSESFCLAAQARLDSKWLKTDIQLAFTRDGLCGLWNEMVKDGEIVYTGTESTQNGELPPRKDDSVEPSG      1 - 70
TKKEDLNDKEKKDEEETPAPIYRAKSILDSWVWGKQPDVNELKECLSVLVKEQQALAVQSATTTLSALRL     71 - 140
KQRLVILERYFIALNRTVFQENVKVKWKSSGISLPPVDKKSSRPAGKGVEGLARVGSRAALSFAFAFLRR    141 - 210
AWRSGEDADLCSELLQESLDALRALPEASLFDESTVSSVWLEVVERATRFLRSVVTGDVHGTPATKGPGS    211 - 280
IPLQDQHLALAILLELAVQRGTLSQMLSAILLLLQLWDSGAQETDNERSAQGTSAPLLPLLQRFQSIICR    281 - 350
KDAPHSEGDMHLLSGPLSPNESFLRYLTLPQDNELAIDLRQTAVVVMAHLDRLATPCMPPLCSSPTSHKG    351 - 420
SLQEVIGWGLIGWKYYANVIGPIQCEGLANLGVTQIACAEKRFLILSRNGRVYTQAYNSDTLAPQLVQGL    421 - 490
ASRNIVKIAAHSDGHHYLALAATGEVYSWGCGDGGRLGHGDTVPLEEPKVISAFSGKQAGKHVVHIACGS    491 - 560
TYSAAITAEGELYTWGRGNYGRLGHGSSEDEAIPMLVAGLKGLKVIDVACGSGDAQTLAVTENGQVWSWG    561 - 630
DGDYGKLGRGGSDGCKTPKLIEKLQDLDVVKVRCGSQFSIALTKDGQVYSWGKGDNQRLGHGTEEHVRYP    631 - 700
KLLEGLQGKKVIDVAAGSTHCLALTEDSEVHSWGSNDQCQHFDTLRVTKPEPAALPGLDTKHIVGIACGP    701 - 770
AQSFAWSSCSEWSIGLRVPFVVDICSMTFEQLDLLLRQVSEGMDGSADWPPPQEKECVAVATLNLLRLQL    771 - 840
HAAISHQVDPEFLGLGLGSILLNSLKQTVVTLASSAGVLSTVQSAAQAVLQSGWSVLLPTAEERARALSA    841 - 910
LLPCAVSGNEVNISPGRRFMIDLLVGSLMADGGLESALHAAITAEIQDIEAKKEAQKEKEIDEQEANAST    911 - 980
FHRSRTPLDKDLINTGICESSGKQCLPLVQLIQQLLRNIASQTVARLKDVARRISSCLDFEQHSRERSAS    981 - 1050
LDLLLRFQRLLISKLYPGESIGQTSDISSPELMGVGSLLKKYTALLCTHIGDILPVAASIASTSWRHFAE   1051 - 1120
VAYIVEGDFTGVLLPELVVSIVLLLSKNAGLMQEAGAVPLLGGLLEHLDRFNHLAPGKERDDHEELAWPG   1121 - 1190
IMESFFTGQNCRNNEEVTLIRKADLENHNKDGGFWTVIDGKVYDIKDFQTQSLTGNSILAQFAGEDPVVA   1191 - 1260
LEAALQFEDTRESMHAFCVGQYLEPDQEIVTIPDLGSLSSPLIDTERNLGLLLGLHASYLAMSTPLSPVE   1261 - 1330
IECAKWLQSSIFSGGLQTSQIHYSYNEEKDEDHCSSPGGTPASKSRLCSHRRALGDHSQAFLQAIADNNI   1331 - 1400
QDHNVKDFLCQIERYCRQCHLTTPIMFPPEHPVEEVGRLLLCCLLKHEDLGHVALSLVHAGALGIEQVKH   1401 - 1470
RTLPKSVVDVCRVVYQAKCSLIKTHQEQGRSYKEVCAPVIERLRFLFNELRPAVCNDLSIMSKFKLLSSL   1471 - 1540
PRWRRIAQKIIRERRKKRVPKKPESTDDEEKIGNEESDLEEACILPHSPINVDKRPIAIKSPKDKWQPLL   1541 - 1610
STVTGVHKYKWLKQNVQGLYPQSPLLSTIAEFALKEEPVDVEKMRKCLLKQLERAEVRLEGIDTILKLAS   1611 - 1680
KNFLLPSVQYAMFCGWQRLIPEGIDIGEPLTDCLKDVDLIPPFNRMLLEVTFGKLYAWAVQNIRNVLMDA   1681 - 1750
SAKFKELGIQPVPLQTITNENPSGPSLGTIPQARFLLVMLSMLTLQHGANNLDLLLNSGMLALTQTALRL   1751 - 1820
IGPSCDNVEEDMNASAQGASATVLEETRKETAPVQLPVSGPELAAMMKIGTRVMRGVDWKWGDQDGPPPG   1821 - 1890
LGRVIGELGEDGWIRVQWDTGSTNSYRMGKEGKYDLKLAELPAAAQPSAEDSDTEDDSEAEQTERNIHPT   1891 - 1960
AMMFTSTINLLQTLCLSAGVHAEIMQSEATKTLCGLLRMLVESGTTDKTSSPNRLVYREQHRSWCTLGFV   1961 - 2030
RSIALTPQVCGALSSPQWITLLMKVVEGHAPFTATSLQRQILAVHLLQAVLPSWDKTERARDMKCLVEKL   2031 - 2100
FDFLGSLLTTCSSDVPLLRESTLRRRRVRPQASLTATHSSTLAEEVVALLRTLHSLTQWNGLINKYINSQ   2101 - 2170
LRSITHSFVGRPSEGAQLEDYFPDSENPEVGGLMAVLAVIGGIDGRLRLGGQVMHDEFGEGTVTRITPKG   2171 - 2240
KITVQFSDMRTCRVCPLNQLKPLPAVAFNVNNLPFTEPMLSVWAQLVNLAGSKLEKHKIKKSTKQAFAGQ   2241 - 2310
VDLDLLRCQQLKLYILKAGRALLSHQDKLRQILSQPAVQETGTVHTDDGAVVSPDLGDMSPEGPQPPMIL   2311 - 2380
LQQLLASATQPSPVKAIFDKQELEAAALAVCQCLAVESTHPSSPGFEDCSSSEATTPVAVQHIRPARVKR   2381 - 2450
RKQSPVPALPIVVQLMEMGFSRRNIEFALKSLTGASGNASSLPGVEALVGWLLDHSDIQVTELSDADTVS   2451 - 2520
DEYSDEEVVEDVDDAAYSMSTGAVVTESQTYKKRADFLSNDDYAVYVRENIQVGMMVRCCRAYEEVCEGD   2521 - 2590
VGKVIKLDRDGLHDLNVQCDWQQKGGTYWVRYIHVELIGYPPPSSSSHIKIGDKVRVKASVTTPKYKWGS   2591 - 2660
VTHQSVGVVKAFSANGKDIIVDFPQQSHWTGLLSEMELVPSIHPGVTCDGCQMFPINGSRFKCRNCDDFD   2661 - 2730
FCETCFKTKKHNTRHTFGRINEPGQSAVFCGRSGKQLKRCHSSQPGMLLDSWSRMVKSLNVSSSVNQASR   2731 - 2800
LIDGSEPCWQSSGSQGKHWIRLEIFPDVLVHRLKMIVDPADSSYMPSLVVVSGGNSLNNLIELKTININP   2801 - 2870
SDTTVPLLNDCTEYHRYIEIAIKQCRSSGIDCKIHGLILLGRIRAEEEDLAAVPFLASDNEEEEDEKGNS   2871 - 2940
GSLIRKKAAGLESAATIRTKVFVWGLNDKDQLGGLKGSKIKVPSFSETLSALNVVQVAGGSKSLFAVTVE   2941 - 3010
GKVYACGEATNGRLGLGISSGTVPIPRQITALSSYVVKKVAVHSGGRHATALTVDGKVFSWGEGDDGKLG   3011 - 3080
HFSRMNCDKPRLIEALKTKRIRDIACGSSHSAALTSSGELYTWGLGEYGRLGHGDNTTQLKPKMVKVLLG   3081 - 3150
HRVIQVACGSRDAQTLALTDEGLVFSWGDGDFGKLGRGGSEGCNIPQNIERLNGQGVCQIECGAQFSLAL   3151 - 3220
TKSGVVWTWGKGDYFRLGHGSDVHVRKPQVVEGLRGKKIVHVAVGALHCLAVTDSGQVYAWGDNDHGQQG   3221 - 3290
NGTTTVNRKPTLVQGLEGQKITRVACGSSHSVAWTTVDVATPSVHEPVLFQTARDPLGASYLGVPSDADS   3291 - 3360
SAASNKISGASNSKPNRPSLAKILLSLDGNLAKQQALSHILTALQIMYARDAVVGALMPAAMIAPVECPS   3361 - 3430
FSSAAPSDASAMASPMNGEECMLAVDIEDRLSPNPWQEKREIVSSEDAVTPSAVTPSAPSASARPFIPVT   3431 - 3500
DDLGAASIIAETMTKTKEDVESQNKAAGPEPQALDEFTSLLIADDTRVVVDLLKLSVCSRAGDRGRDVLS   3501 - 3570
AVLSGMGTAYPQVADMLLELCVTELEDVATDSQSGRLSSQPVVVESSHPYTDDTSTSGTVKIPGAEGLRV   3571 - 3640
EFDRQCSTERRHDPLTVMDGVNRIVSVRSGREWSDWSSELRIPGDELKWKFISDGSVNGWGWRFTVYPIM   3641 - 3710
PAAGPKELLSDRCVLSCPSMDLVTCLLDFRLNLASNRSIVPRLAASLAACAQLSALAASHRMWALQRLRK   3711 - 3780
LLTTEFGQSININRLLGENDGETRALSFTGSALAALVKGLPEALQRQFEYEDPIVRGGKQLLHSPFFKVL   3781 - 3850
VALACDLELDTLPCCAETHKWAWFRRYCMASRVAVALDKRTPLPRLFLDEVAKKIRELMADSENMDVLHE   3851 - 3920
SHDIFKREQDEQLVQWMNRRPDDWTLSAGGSGTIYGWGHNHRGQLGGIEGAKVKVPTPCEALATLRPVQL   3921 - 3990
IGGEQTLFAVTADGKLYATGYGAGGRLGIGGTESVSTPTLLESIQHVFIKKVAVNSGGKHCLALSSEGEV   3991 - 4060
YSWGEAEDGKLGHGNRSPCDRPRVIESLRGIEVVDVAAGGAHSACVTAAGDLYTWGKGRYGRLGHSDSED   4061 - 4130
QLKPKLVEALQGHRVVDIACGSGDAQTLCLTDDDTVWSWGDGDYGKLGRGGSDGCKVPMKIDSLTGLGVV   4131 - 4200
KVECGSQFSVALTKSGAVYTWGKGDYHRLGHGSDDHVRRPRQVQGLQGKKVIAIATGSLHCVCCTEDGEV   4201 - 4270
YTWGDNDEGQLGDGTTNAIQRPRLVAALQGKKVNRVACGSAHTLAWSTSKPASAGKLPAQVPMEYNHLQE   4271 - 4340
IPIIALRNRLLLLHHLSELFCPCIPMFDLEGSLDETGLGPSVGFDTLRGILISQGKEAAFRKVVQATMVR   4341 - 4410
DRQHGPVVELNRIQVKRSRSKGGLAGPDGTKSVFGQMCAKMSSFGPDSLLLPHRVWKVKFVGESVDDCGG   4411 - 4480
GYSESIAEICEELQNGLTPLLIVTPNGRDESGANRDCYLLSPAARAPVHSSMFRFLGVLLGIAIRTGSPL   4481 - 4550
SLNLAEPVWKQLAGMSLTIADLSEVDKDFIPGLMYIRDNEATSEEFEAMSLPFTVPSASGQDIQLSSKHT   4551 - 4620
HITLDNRAEYVRLAINYRLHEFDEQVAAVREGMARVVPVPLLSLFTGYELETMVCGSPDIPLHLLKSVAT   4621 - 4690
YKGIEPSASLIQWFWEVMESFSNTERSLFLRFVWGRTRLPRTIADFRGRDFVIQVLDKYNPPDHFLPESY   4691 - 4760
TCFFLLKLPRYSCKQVLEEKLKYAIHFCKSIDTDDYARIALTGEPAADDSSDDSDNEDVDSFASDSTQDY   4761 - 4830
LTGH                                                                     4831 - 4834
//

Text Mined References (70)

PMID Year Title
26436293 2015 Ferritinophagy via NCOA4 is required for erythropoiesis and is regulated by iron dependent HERC2-mediated proteolysis.
25305019 2014 The histone H2A deubiquitinase USP16 interacts with HERC2 and fine-tunes cellular response to DNA damage.
24855649 2014 Degradation of the deubiquitinating enzyme USP33 is mediated by p97 and the ubiquitin ligase HERC2.
24778179 2014 HERC2 targets the iron regulator FBXL5 for degradation and modulates iron metabolism.
24722987 2014 The E3 ubiquitin protein ligase HERC2 modulates the activity of tumor protein p53 by regulating its oligomerization.
23601698 2013 Gender is a major factor explaining discrepancies in eye colour prediction based on HERC2/OCA2 genotype and the IrisPlex model.
23548203 2013 Genome-wide association studies identify several new loci associated with pigmentation traits and skin cancer risk in European Americans.
23502783 2013 The CCND1 c.870G>A polymorphism is a risk factor for t(11;14)(q13;q32) multiple myeloma.
23243086 2013 Mutation of HERC2 causes developmental delay with Angelman-like features.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23178497 2014 Coordinated regulation of XPA stability by ATR and HERC2 during nucleotide excision repair.
23118974 2012 Genome-wide association studies of quantitatively measured skin, hair, and eye pigmentation in four European populations.
23065719 2012 A homozygous missense mutation in HERC2 associated with global developmental delay and autism spectrum disorder.
22561518 2012 Genome-wide association analyses identify 13 new susceptibility loci for generalized vitiligo.
22508508 2012 DNA damage-inducible SUMOylation of HERC2 promotes RNF8 binding via a novel SUMO-binding Zinc finger.
22261722 2012 Interaction proteomics identify NEURL4 and the HECT E3 ligase HERC2 as novel modulators of centrosome architecture.
22234890 2012 HERC2 rs12913832 modulates human pigmentation by attenuating chromatin-loop formation between a long-range enhancer and the OCA2 promoter.
22124266 2011 Frameshift mutations of ubiquitination-related genes HERC2, HERC3, TRIP12, UBE2Q1 and UBE4B in gastric and colorectal carcinomas with microsatellite instability.
21775519 2011 HERC2 Interacts with Claspin and regulates DNA origin firing and replication fork progression.
21493713 2011 Physical and functional interaction of the HECT ubiquitin-protein ligases E6AP and HERC2.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21197618 2011 Model-based prediction of human hair color using DNA variants.
20886065 2010 Molecular reclassification of Crohn's disease by cluster analysis of genetic variants.
20631078 2010 HERC2 is an E3 ligase that targets BRCA1 for degradation.
20629734 2010 Genetic analysis of three important genes in pigmentation and melanoma susceptibility: CDKN2A, MC1R and HERC2/OCA2.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20616560 2010 Genetic differences between five European populations.
20585627 2010 Web-based, participant-driven studies yield novel genetic associations for common traits.
20463881 2010 Digital quantification of human eye color highlights genetic association of three new loci.
20457063 2010 Human eye colour and HERC2, OCA2 and MATP.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20304803 2010 Circadian control of XPA and excision repair of cisplatin-DNA damage by cryptochrome and HERC2 ubiquitin ligase.
20176734 2010 Comparative genetic analysis of inflammatory bowel disease and type 1 diabetes implicates multiple loci with opposite effects.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20023648 2010 HERC2 coordinates ubiquitin-dependent assembly of DNA repair factors on damaged chromosomes.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19472299 2009 Genotyping of five single nucleotide polymorphisms in the OCA2 and HERC2 genes associated with blue-brown eye color in the Japanese population.
19422935 2009 Genetic risk profiling and prediction of disease course in Crohn's disease patients.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19208107 2009 Interactions between HERC2, OCA2 and MC1R may influence human pigmentation phenotype.
19174780 2009 Confirmation of multiple Crohn's disease susceptibility loci in a large Dutch-Belgian cohort.
19068216 2009 Investigation of Crohn's disease risk loci in ulcerative colitis further defines their molecular relationship.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18528436 2008 Linkage and association analysis of spectrophotometrically quantified hair color in Australian adolescents: the effect of OCA2 and HERC2.
18483556 2008 A genome-wide association study identifies novel alleles associated with hair color and skin pigmentation.
18438405 2008 Replication of signals from recent studies of Crohn's disease identifies previously unknown disease loci for ulcerative colitis.
18252222 2008 A single SNP in an evolutionary conserved region within intron 86 of the HERC2 gene determines human blue-brown eye color.
18252221 2008 Three genome-wide association studies and a linkage analysis identify HERC2 as a human iris color gene.
18172690 2008 Blue eye color in humans may be caused by a perfectly associated founder mutation in a regulatory element located within the HERC2 gene inhibiting OCA2 expression.
17952075 2007 Genetic determinants of hair, eye and skin pigmentation in Europeans.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15203218 2004 Circular rapid amplification of cDNA ends for high-throughput extension cloning of partial genes.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11752456 2001 Insight into hepatocellular carcinogenesis at transcriptome level by comparing gene expression profiles of hepatocellular carcinoma with those of corresponding noncancerous liver.
11337467 2001 Identification and characterization of the potential promoter regions of 1031 kinds of human genes.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10720573 2000 Structure of the highly conserved HERC2 gene and of multiple partially duplicated paralogs in human.
10441737 1999 Molecular characterization of radiation- and chemically induced mutations associated with neuromuscular tremors, runting, juvenile lethality, and sperm defects in jdf2 mice.
9949213 1999 The ancestral gene for transcribed, low-copy repeats in the Prader-Willi/Angelman region encodes a large protein implicated in protein trafficking, which is deficient in mice with neuromuscular and spermiogenic abnormalities.
9205841 1997 Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.