Property Summary

NCBI Gene PubMed Count 33
PubMed Score 42.27
PubTator Score 40.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
medulloblastoma -4.400 1.2e-10
atypical teratoid / rhabdoid tumor -4.100 1.4e-09
glioblastoma -1.900 4.8e-03
medulloblastoma, large-cell -4.300 1.9e-08
primitive neuroectodermal tumor -2.500 9.7e-03
breast carcinoma -1.400 7.6e-04
fibroadenoma -1.700 4.6e-02
pediatric high grade glioma -1.300 8.9e-03
ductal carcinoma in situ -2.200 3.1e-04
invasive ductal carcinoma -2.300 2.3e-03
psoriasis -1.600 1.8e-15

Gene RIF (30)

PMID Text
26677113 Due to the ability to reactivate expression of hepaCAM and inhibit growth of bladder cancer cells, AZAC may represent an effective treatment for bladder cancer.
26033718 The extracellular domain of GlialCAM is necessary for cell junction targeting and for mediating interactions with itself or with MLC1 and ClC-2.
25185546 GlialCAM is able to interact with all CLC channels tested in this study, targeting them to cell junctions and activating them by stabilizing the open configuration of the common gate
25044933 Results allow classifying the effect of HEPACAM gene mutations in different subtypes and authors indicate different cellular mechanisms that lead to megalencephalic leukoencephalopathy pathogenesis.
24824219 we demonstrate an evolutionary conserved role for MLC1 in regulating glial surface levels of GLIALCAM, and this interrelationship explains why patients with mutations in either gene (MLC1 or GLIALCAM) share the same clinical phenotype.
24811146 results suggested that HepaCAM acted as a tumor suppressor in prostate cancer
24645843 High expression of hepaCAM is associated with renal carcinoma.
24580998 No clear association between GLIALCAM mutations and an autism-epilepsy phenotype.
24515280 HepaCAM may prevent the translocation of PKCepsilon from cytosolic to particulate fractions, resulting in the inhibition of 786-0 cell proliferation.
24324362 Re-activation of hepaCAM gene by 5-aza-CdR can inhibit growth of cancer cells and arrest cells at G0/G1 phase
24202401 analysis of mutations in GLIALCAM in patients with megalencephalic leukoencephalopathy with subcortical cysts [case report]
23793458 results indicate GlialCAM is necessary for MLC1 protein expression, and its reduction affects the activity of volume-regulated anion currents (VRAC) which may cause astrocyte vacuolation; work extends the role of GlialCAM as a chaperone of MLC1 needed for proper VRAC activation
22906662 Results suggest an important connection between HEPACAM and interferon-gamma, which may inhibit BIU-87 proliferation through HEPACAM re-expression and p21(WAF1) up-regulation to arrest cells at the G(0)/G(1) phase
21624973 study presents more detailed characterization of the effect of mutations found in MLC1 and GLIALCAM megalencephalic leukoencephalopathy with subcortical cysts
21618595 Research implies that the decrease in c-Myc protein expression, resulting from ectopic expression of hepaCAM, may contribute to the inhibition of proliferation in these cells.
21419380 Dominant HEPACAM mutations can cause either macrocephaly and mental retardation with or without autism or benign familial macrocephaly.
20628239 Downregulation of hepaCAM expression plays an important role in the tumorigenesis and development of bladder cancer
20593288 There is a close relationship between hepaCAM and VEGF in urothelial carcinoma
20514407 The truncation mutant of hepaCAM failed to promote cell-ECM adhesion and migration, and lost the inhibitory effects on cell growth, suggesting a regulatory role of the cleavage in hepaCAM functions.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20205955 HepaCAM is involved in cell adhesion and growth control, and its expression is frequently silenced in TCCB. The extracellular domain of hepaCAM is essential to its physiological and biological functions.
19507233 high expression of hepaCAM significantly accelerated cell adhesion but inhibited cell proliferation and migration; cell differentiation was noticeably less apparent in cells expressing low-level hepaCAM
19142852 The data suggest that an intact hepaCAM protein is critical for establishing a stable physical association with the actin cytoskeleton; and such association is important for modulating hepaCAM-mediated cell adhesion and motility.
19059381 hepaCAM is partially localized in the lipid rafts/caveolae and interacts with Cav-1 through its first immunoglobulin domain.
18845560 the expression of hepaCAM in MCF7 cells not only inhibits cell growth but also induces cellular senescence through the p53/21 pathway
18293412 GlialCAM, an immunoglobulin-like cell adhesion molecule is expressed in glial cells of the central nervous system.
18082421 study examined the glycosylation of the GlialCAM (hepaCAM) extracellular domain expressed in HEK and CHO cells
15917256 the cytoplasmic domain of hepaCAM is essential to its function on cell-matrix interaction and cell motility
15885354 encodes an Ig-like transmembrane glycoprotein and is involved in cell adhesion and growth control
12971969 HEPN1 is frequently silenced in HCC, and exogenous HEPN1 exhibits antiproliferative effect on HepG2 cells, suggesting that silencing of HEPN1 may be associated with carcinogenesis of hepatocytes.

AA Sequence

MKRERGALSRASRALRLAPFVYLLLIQTDPLEGVNITSPVRLIHGTVGKSALLSVQYSSTSSDRPVVKWQ      1 - 70
LKRDKPVTVVQSIGTEVIGTLRPDYRDRIRLFENGSLLLSDLQLADEGTYEVEISITDDTFTGEKTINLT     71 - 140
VDVPISRPQVLVASTTVLELSEAFTLNCSHENGTKPSYTWLKDGKPLLNDSRMLLSPDQKVLTITRVLME    141 - 210
DDDLYSCMVENPISQGRSLPVKITVYRRSSLYIILSTGGIFLLVTLVTVCACWKPSKRKQKKLEKQNSLE    211 - 280
YMDQNDDRLKPEADTLPRSGEQERKNPMALYILKDKDSPETEENPAPEPRSATEPGPPGYSVSPAVPGRS    281 - 350
PGLPIRSARRYPRSPARSPATGRTHSSPPRAPSSPGRSRSASRTLRTAGVHIIREQDEAGPVEISA        351 - 416
//

Text Mined References (36)

PMID Year Title
26677113 2016 5-azacytidine inhibits the proliferation of bladder cancer cells via reversal of the aberrant hypermethylation of the hepaCAM gene.
26033718 2015 Structural determinants of interaction, trafficking and function in the ClC-2/MLC1 subunit GlialCAM involved in leukodystrophy.
25185546 2014 GlialCAM, a CLC-2 Cl(-) channel subunit, activates the slow gate of CLC chloride channels.
25044933 2014 Functional analyses of mutations in HEPACAM causing megalencephalic leukoencephalopathy.
24824219 2014 Megalencephalic leukoencephalopathy with subcortical cysts protein 1 regulates glial surface localization of GLIALCAM from fish to humans.
24811146 2014 Overexpression of HepaCAM inhibits cell viability and motility through suppressing nucleus translocation of androgen receptor and ERK signaling in prostate cancer.
24645843 2014 Renal tumor-derived exosomes inhibit hepaCAM expression of renal carcinoma cells in a p-AKT-dependent manner.
24580998 2014 Autism-epilepsy phenotype with macrocephaly suggests PTEN, but not GLIALCAM, genetic screening.
24515280 2014 HepaCAM inhibits clear cell renal carcinoma 786-0 cell proliferation via blocking PKC? translocation from cytoplasm to plasma membrane.
24324362 2013 Identification of hypermethylation in hepatocyte cell adhesion molecule gene promoter region in bladder carcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24202401 2014 Expanding the spectrum of megalencephalic leukoencephalopathy with subcortical cysts in two patients with GLIALCAM mutations.
23793458 2013 Insights into MLC pathogenesis: GlialCAM is an MLC1 chaperone required for proper activation of volume-regulated anion currents.
22906662 2012 Exploration of the correlations between interferon-? in patient serum and HEPACAM in bladder transitional cell carcinoma, and the interferon-? mechanism inhibiting BIU-87 proliferation.
22328087 2012 Megalencephalic leukoencephalopathy with subcortical cysts protein 1 functionally cooperates with the TRPV4 cation channel to activate the response of astrocytes to osmotic stress: dysregulation by pathological mutations.
21624973 2011 Molecular mechanisms of MLC1 and GLIALCAM mutations in megalencephalic leukoencephalopathy with subcortical cysts.
21618595 2011 HepaCAM induces G1 phase arrest and promotes c-Myc degradation in human renal cell carcinoma.
21419380 2011 Mutant GlialCAM causes megalencephalic leukoencephalopathy with subcortical cysts, benign familial macrocephaly, and macrocephaly with retardation and autism.
20628239 2010 Exon 2 methylation inhibits hepaCAM expression in transitional cell carcinoma of the bladder.
20593288 2010 Expression and clinical significance of hepaCAM and VEGF in urothelial carcinoma.
20514407 2010 The immunoglobulin-like cell adhesion molecule hepaCAM is cleaved in the human breast carcinoma MCF7 cells.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20205955 2010 Functional significance of the hepaCAM gene in bladder cancer.
19507233 2009 The immunoglobulin-like cell adhesion molecule hepaCAM induces differentiation of human glioblastoma U373-MG cells.
19142852 2009 The immunoglobulin-like cell adhesion molecule hepaCAM modulates cell adhesion and motility through direct interaction with the actin cytoskeleton.
19059381 2009 Interaction of the immunoglobulin-like cell adhesion molecule hepaCAM with caveolin-1.
18845560 2008 Expression of hepaCAM is downregulated in cancers and induces senescence-like growth arrest via a p53/p21-dependent pathway in human breast cancer cells.
18293412 2008 GlialCAM, an immunoglobulin-like cell adhesion molecule is expressed in glial cells of the central nervous system.
18082421 2008 Purification of the extracellular domain of the membrane protein GlialCAM expressed in HEK and CHO cells and comparison of the glycosylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15917256 2005 Structural and functional analyses of a novel ig-like cell adhesion molecule, hepaCAM, in the human breast carcinoma MCF7 cells.
15885354 2005 Cloning and characterization of hepaCAM, a novel Ig-like cell adhesion molecule suppressed in human hepatocellular carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.