Property Summary

NCBI Gene PubMed Count 6
PubMed Score 16.31
PubTator Score 2.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
tuberculosis 1963 8.5e-07
medulloblastoma, large-cell 6086 6.5e-05
osteosarcoma 7766 1.0e-04
ovarian cancer 8297 1.6e-04
psoriasis 6514 1.4e-03
Disease Target Count Z-score Confidence
Leptospirosis 18 4.518 2.3

Expression

  Differential Expression (5)

Disease log2 FC p
medulloblastoma, large-cell 1.100 6.5e-05
osteosarcoma -1.301 1.0e-04
ovarian cancer 1.100 1.6e-04
psoriasis 1.100 1.4e-03
tuberculosis 1.300 8.5e-07

Gene RIF (2)

AA Sequence

MELWGRMLWALLSGPGRRGSTRGWAFSSWQPQPPLAGLSSAIELVSHWTGVFEKRGIPEARESSEYIVAH      1 - 70
VLGAKTFQSLRPALWTQPLTSQQLQCIRELSSRRLQRMPVQYILGEWDFQGLSLRMVPPVFIPRPETEEL     71 - 140
VEWVLEEVAQRSHAVGSPGSPLILEVGCGSGAISLSLLSQLPQSRVIAVDKREAAISLTHENAQRLRLQD    141 - 210
RIWIIHLDMTSERSWTHLPWGPMDLIVSNPPYVFHQDMEQLAPEIRSYEDPAALDGGEEGMDIITHILAL    211 - 280
APRLLKDSGSIFLEVDPRHPELVSSWLQSRPDLYLNLVAVRRDFCGRPRFLHIRRSGP                281 - 338
//

Text Mined References (6)

PMID Year Title