Property Summary

NCBI Gene PubMed Count 15
PubMed Score 107.49
PubTator Score 252.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... -1.200 8.4e-04
intraductal papillary-mucinous carcinoma... -2.800 3.1e-04
intraductal papillary-mucinous neoplasm ... -1.500 9.7e-03
lung adenocarcinoma -1.300 1.6e-11
lung cancer -1.300 4.3e-04
lung carcinoma -1.300 2.2e-13
malignant mesothelioma -1.800 3.0e-07
Multiple myeloma 1.752 1.1e-03
oligodendroglioma -2.000 3.2e-02
osteosarcoma -1.593 1.8e-03
ovarian cancer -2.800 1.6e-09
tuberculosis 1.500 1.4e-07
ulcerative colitis -1.100 8.8e-03

Gene RIF (8)

AA Sequence

MLGMIKNSLFGSVETWPWQVLSKGDKEEVAYEERACEGGKFATVEVTDKPVDEALREAMPKVAKYAGGTN      1 - 70
DKGIGMGMTVPISFAVFPNEDGSLQKKLKVWFRIPNQFQSDPPAPSDKSVKIEEREGITVYSMQFGGYAK     71 - 140
EADYVAQATRLRAALEGTATYRGDIYFCTGYDPPMKPYGRRNEIWLLKT                         141 - 189
//

Text Mined References (19)

PMID Year Title