Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.90
PubTator Score 0.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Weight Gain 95 0.0 0.0

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell -1.300 3.9e-06
ovarian cancer -2.500 5.0e-11
pancreatic ductal adenocarcinoma liver m... -1.615 2.9e-02

AA Sequence

MAACRALKAVLVDLSGTLHIEDAAVPGAQEALKRLRGASVIIRFVTNTTKESKQDLLERLRKLEFDISED      1 - 70
EIFTSLTAARSLLERKQVRPMLLVDDRALPDFKGIQTSDPNAVVMGLAPEHFHYQILNQAFRLLLDGAPL     71 - 140
IAIHKARYYKRKDGLALGPGPFVTALEYATDTKATVVGKPEKTFFLEALRGTGCEPEEAVMIGDDCRDDV    141 - 210
GGAQDVGMLGILVKTGKYRASDEEKINPPPYLTCESFPHAVDHILQHLL                         211 - 259
//

Text Mined References (12)

PMID Year Title