Property Summary

NCBI Gene PubMed Count 69
PubMed Score 125.70
PubTator Score 125.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (11)

Disease log2 FC p
osteosarcoma -1.384 2.1e-03
atypical teratoid / rhabdoid tumor 1.400 8.7e-08
glioblastoma 1.100 1.2e-03
medulloblastoma 1.100 2.8e-06
medulloblastoma, large-cell 1.800 1.3e-05
primitive neuroectodermal tumor 1.100 3.5e-04
lung cancer 1.500 1.8e-04
colon cancer 1.100 1.2e-02
invasive ductal carcinoma 1.200 7.9e-04
ovarian cancer 2.600 3.4e-08
Breast cancer 1.200 1.9e-05

Gene RIF (55)

PMID Text
26845719 describe two previously unknown HDGF isoforms, HDGF-B and HDGF-C, generated via alternative splicing with structurally unrelated N-terminal regions of their hath region
26612514 study uncovers a novel function of HDGF as a messenger of cellular condition (alarmin) which in-turn modulates cellular function-aspects that could be used as a biomarker for ovarian cancer.
26296979 HDGF and beta-catenin interact as a positive feedback loop, which plays an important role in carcinogenesis and progression of colorectal carcinoma.
26081074 HDGF is important in promoting malignant biological behaviors, including proliferation, migration and invasion of hilar cholangiocarcinoma cells.
26067205 HDGF contains conserved N-terminal HATH domains with a characteristic structural motif, namely the PWWP motif. This study defines the role of the first residue of the PWWP motif in modulating HATH domain stability and oligomer formation in binding.
25938538 Hepatoma-derived growth factor overexpression is involved in liver carcinogenesis.
25773828 Meta-analysis results provide evidence that HDGF may be a new indicator of poor cancer prognosis.
25677618 These data suggested that irradiated fibroblasts promoted invasion, growth, EMT and HDGF expression of ESCC.
25421244 HDGF overexpression is common in early-stage cervical adenocarcinoma.
25275311 The expression level of hepatoma-derived growth factor (HDGF) significantly decreased in response to the virus-associated RNAs under replication-deficient condition.
25262276 HDGF can promote IHCC cells progression, including proliferation, invasion, and angiogenesis
25071353 The expression of nuclear HDGF might be closely related to the carcinogenesis, clinical biological behaviors, and prognosis of gallbladder adenocarcinoma.
24986090 Results suggest that HDGF downregulation significantly suppresses glioma cell proliferation, migration, invasion in vitro and tumorigenesis in vivo is probably involved in the activation of both the PI3K/Akt and the TGF-beta signaling pathways
24891187 Data indicate that hepatoma-derived growth factor (HDGF) was a target of miR-195 in non-small cell lung cancer (NSCLC) cells.
24770635 ADAM9 high expression is correlated positively and significantly with HDGF high expression in non-small cell lung cancer.
24692842 HDGF is a potential unfavorable factor for the progression and prognosis of endometrial carcinoma.
24276755 expression of HDGF was negatively correlated with miR-141 in gastric cancer tissues: the suppressive effects of miR-141 on GC cell proliferation, colony formation, in vitro migration, and invasion were partially mediated by suppressing HDGF expression.
24072730 Combining p53 expression and HDGF expression significantly improved prognostic stratification for patients with Ewing family tumor.
23954293 The suppressive effect of miR-16 on cell proliferation, colony formation, migration, and invasion is partially mediated by inhibiting HDGF expression.
23878072 Suggest that HDGF exhibits oncogenic properties and may be a novel prognostic factor in Ewing's sarcoma.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of hepatoma-derived growth factor (HDGF) expression by HIV-1 Vpr in Vpr transduced macrophages
23793608 Positive expression of HDGF was detected in 46.2 % of patients with extrahepatic cholangiocarcinoma and correlated with poor tumor differentiation. The HDGF expression group had lower survival than the negative HDGF expression group.
23771798 Patients with higher HDGF and CD31 expression level had poorer overall survival rates.
23673296 Tumor samples from non-small cell lung cancers show an inverse relationship between microRNA-497 and HDGF levels, and ectopic expression of miR-497 significantly inhibited tumor growth and angiogenesis in a xenograft model
23609195 Studied HDGF in gallbladder cancer (GBC).Patients with nuclear HDGF-pos tumors had worse survival than patients with HDGF-negative tumors. Treatment of GBC-SD and SGC-996 lines with HDGF-siRNA significantly reduced the proliferation of GBC cell lines.
23536873 Up-regulation of hepatoma-derived growth factor facilities tumor progression in malignant melanoma.
23468531 Together, these results indicate that HDGF downregulation participates in POMC-induced suppression of metastasis and EMT in melanoma.
23305559 Expression of a cytosolic variant of hepatoma-derived growth factor causes a redistribution of nucleolin into the cytoplasm.
22361040 Hepatoma-derived growth factor overexpression contributes to the oncogenic processes in oral cancer cells
22331796 Differential proteomic analysis of human glioblastoma and neural stem cells reveals HDGF as a novel angiogenic secreted factor
22247069 Hepatoma-derived growth factor regulates breast cancer cell invasion by modulating epithelial--mesenchymal transition.
22037800 High hepatoma-derived growth factor is associated with gliomas.
22006999 found that HDGF was overexpressed also in primary gastric, breast, and lung cancer tissues harboring mutant p53 genes
21907836 The interactome suggests that HDGF is a multifunctional protein and participates in many cellular events, including ribosome biogenesis, RNA processing, DNA damage repair and transcriptional regulation.
21426662 HDGF was highly expressed in 158 non-small cell lung cancer tissues compared with normal control.
21302807 results suggest that HDGF is involved in cell growth, cell invasion, and apoptosis
21255068 Increased nuclear expression of HDGF is a potential unfavourable prognostic factor for patients with hepatoma-derived growth factor
20848225 High HDGF is associated with hilar cholangiocarcinoma.
20846397 High HDGF expression is associated with poor overall survival in patients with hepatocellular carcinoma. Down-regulation of HDGF inhibits the growth, anchorage-independent growth, migration and invasion of HepG2 cells.
19924574 High hepatoma-derived growth factor is associated with colorectal carcinoma.
19710540 Mechanistic study on growth suppression and apoptosis induction by targeting HDGF in human hepatocellular carcinoma HepG2 cells is reported.
19432814 The present study is aimed at examining the role of HDGF in keloid pathogenesis.
19162039 HDGF functions as a transcriptional repressor of the SMYD1 gene through interaction with the transcriptional corepressor CtBP.
19144156 Quantitative RT-PCR to study the expression levels of the most interesting gene, HDGF, confirmed that its expression was higher in Ewing sarcoma than in control samples.
18651222 HDGF knock-down was found to induce the expression of the pro-apoptotic protein Bad and also inactivate ERK and Akt, which in turn led to dephosphorylation of Bad at Ser-112, Ser-136, and activation of the intrinsic apoptotic pathway.
18478933 HDGF expression is upgraded in postoperative stage I non-small cell lung cancer patients, and is a significantly independent predictive factor.
18331345 HDGF serves as a template for small ubiquitin-related modifier 1 (SUMO-1) conjugation, although it does not contain a suitable consensus site for SUMOylation.
17974029 The N-terminal PWWP domain of HDGF is required for DNA binding. HDGF exerts its transcription repressive effect through binding to a conserved DNA element in the promoter of target genes.
17473954 Hepatoma-derived growth factor expression level was shown to be associated with recurrence and prognosis of squamous cell carcinoma of the esophagus.
17062679 HDGF may be a novel prognostic factor for pancreatic ductal carcinoma.
15870924 Increased HDGF expression is associated with intratumor microvessel density in non-small-cell lung cancer
15017145 NMR analysis of the hath-domain of human hepatoma-derived growth factor
14751852 HDGF is a highly expressed vascular endothelial cell protein in vivo and is a potent endothelial mitogen and regulator of endothelial cell migration by mechanisms distinct from VEGF.
12972397 may be involved in lung remodeling after injury
11751870 Hepatoma-derived growth factor stimulates cell growth after translocation to the nucleus

AA Sequence

MSRSNRQKEYKCGDLVFAKMKGYPHWPARIDEMPEAAVKSTANKYQVFFFGTHETAFLGPKDLFPYEESK      1 - 70
EKFGKPNKRKGFSEGLWEIENNPTVKASGYQSSQKKSCVEEPEPEPEAAEGDGDKKGNAEGSSDEEGKLV     71 - 140
IDEPAKEKNEKGALKRRAGDLLEDSPKRPKEAENPEGEEKEAATLEVERPLPMEVEKNSTPSEPGSGRGP    141 - 210
PQEEEEEEDEEEEATKEDAEAPGIRDHESL                                            211 - 240
//

Text Mined References (92)

PMID Year Title
26845719 2016 Two new isoforms of the human hepatoma-derived growth factor interact with components of the cytoskeleton.
26612514 2016 Hepatoma derived growth factor (HDGF) dynamics in ovarian cancer cells.
26296979 2015 Positive feedback loop of hepatoma-derived growth factor and ?-catenin promotes carcinogenesis of colorectal cancer.
26081074 2015 Downregulation of the expression of HDGF attenuates malignant biological behaviors of hilar cholangiocarcinoma cells.
26067205 2015 The First Residue of the PWWP Motif Modulates HATH Domain Binding, Stability, and Protein-Protein Interaction.
25938538 2015 Hepatoma-derived growth factor/nucleolin axis as a novel oncogenic pathway in liver carcinogenesis.
25773828 2015 Prognostic role of hepatoma-derived growth factor in solid tumors of Eastern Asia: a systematic review and meta- analysis.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25677618 2015 Irradiated fibroblasts promote epithelial-mesenchymal transition and HDGF expression of esophageal squamous cell carcinoma.
25421244 2014 Hepatoma-derived growth factor upregulation is correlated with prognostic factors of early-stage cervical adenocarcinoma.
25275311 2014 Adenovirus-encoding virus-associated RNAs suppress HDGF gene expression to support efficient viral replication.
25262276 2015 Hepatoma-derived growth factor: a novel prognostic biomarker in intrahepatic cholangiocarcinoma.
25236340 2014 HDGF: a novel jack-of-all-trades in cancer.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
25071353 2014 Prognostic significance of nuclear hepatoma-derived growth factor expression in gallbladder cancer.
24986090 2014 A complex mechanism for HDGF-mediated cell growth, migration, invasion, and TMZ chemosensitivity in glioma.
24891187 2014 MiR-195 targets HDGF to inhibit proliferation and invasion of NSCLC cells.
24770635 2014 HDGF and ADAM9 are novel molecular staging biomarkers, prognostic biomarkers and predictive biomarkers for adjuvant chemotherapy in surgically resected stage I non-small cell lung cancer.
24692842 2014 High nuclear expression of HDGF correlates with disease progression and poor prognosis in human endometrial carcinoma.
24276755 2014 miR-141 suppresses proliferation and motility of gastric cancer cells by targeting HDGF.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
24072730 2014 p53 and hepatoma-derived growth factor expression and their clinicopathological association with Ewing family tumour.
23954293 2013 Downregulation of miR-16 promotes growth and motility by targeting HDGF in non-small cell lung cancer cells.
23878072 2013 Clinical and biological significance of hepatoma-derived growth factor in Ewing's sarcoma.
23793608 2013 Identification of hepatoma-derived growth factor as a potential prognostic and diagnostic marker for extrahepatic cholangiocarcinoma.
23771798 2013 The expression of hepatoma-derived growth factor in primary central nervous system lymphoma and its correlation with angiogenesis, proliferation and clinical outcome.
23673296 2013 Downregulation of miR-497 promotes tumor growth and angiogenesis by targeting HDGF in non-small cell lung cancer.
23609195 2013 Downregulated expression of hepatoma-derived growth factor (HDGF) reduces gallbladder cancer cell proliferation and invasion.
23536873 2013 Up-regulation of hepatoma-derived growth factor facilitates tumor progression in malignant melanoma [corrected].
23468531 2013 Downregulation of hepatoma-derived growth factor contributes to retarded lung metastasis via inhibition of epithelial-mesenchymal transition by systemic POMC gene delivery in melanoma.
23305559 2013 Hepatoma-derived growth factor and nucleolin exist in the same ribonucleoprotein complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22361040 2012 The expression and prognostic significance of hepatoma-derived growth factor in oral cancer.
22331796 2012 Differential proteomic analysis of human glioblastoma and neural stem cells reveals HDGF as a novel angiogenic secreted factor.
22247069 2012 Hepatoma-derived growth factor regulates breast cancer cell invasion by modulating epithelial--mesenchymal transition.
22037800 2012 Tumorigenesis and prognostic role of hepatoma-derived growth factor in human gliomas.
22006999 2011 p53 negatively regulates the hepatoma growth factor HDGF.
21907836 2011 Interactome study suggests multiple cellular functions of hepatoma-derived growth factor (HDGF).
21426662 2011 [Aberrant expression of HDGF and its prognostic values in surgically resected non-small cell lung cancer].
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21302807 2010 Hepatoma-derived growth factor regulates the bad-mediated apoptotic pathway and induction of vascular endothelial growth factor in stomach cancer cells.
21269460 2011 Initial characterization of the human central proteome.
21255068 2011 Increased expression of hepatoma-derived growth factor correlates with poor prognosis in human nasopharyngeal carcinoma.
20848225 2011 Expression and clinical significance of hepatoma-derived growth factor as a prognostic factor in human hilar cholangiocarcinoma.
20846397 2010 Overexpressed HDGF as an independent prognostic factor is involved in poor prognosis in Chinese patients with liver cancer.
20551380 2010 Proteomics characterization of extracellular space components in the human aorta.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19924574 2010 Apoptosis of human colorectal carcinoma cells is induced by blocking hepatoma-derived growth factor.
19710540 2009 Mechanistic study on growth suppression and apoptosis induction by targeting hepatoma-derived growth factor in human hepatocellular carcinoma HepG2 cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19432814 2010 Hepatoma-derived growth factor and its role in keloid pathogenesis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19367720 2008 Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.
19162039 2009 Hepatoma-derived growth factor represses SET and MYND domain containing 1 gene expression through interaction with C-terminal binding protein.
19144156 2009 Combined use of expression and CGH arrays pinpoints novel candidate genes in Ewing sarcoma family of tumors.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18651222 2008 Downregulation of hepatoma-derived growth factor activates the Bad-mediated apoptotic pathway in human cancer cells.
18478933 2007 [Expression of HDGF and its implication in stage I non-small cell lung cancer].
18331345 2008 SUMOylation of the hepatoma-derived growth factor negatively influences its binding to chromatin.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
18088087 2008 Phosphoproteome of resting human platelets.
17974029 2007 Hepatoma-derived growth factor binds DNA through the N-terminal PWWP domain.
17487921 2007 Toward a global characterization of the phosphoproteome in prostate cancer cells: identification of phosphoproteins in the LNCaP cell line.
17487837 2007 Hepatoma-derived growth factor is a novel prognostic factor for gastrointestinal stromal tumors.
17473954 2007 Expression level of hepatoma-derived growth factor correlates with tumor recurrence of esophageal carcinoma.
17270212 2007 PWWP module of human hepatoma-derived growth factor forms a domain-swapped dimer with much higher affinity for heparin.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17062679 2006 Hepatoma-derived growth factor is a novel prognostic factor for patients with pancreatic cancer.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16807684 2006 Phosphoproteomic analysis of the human pituitary.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15560738 Alterations in mitochondrial and apoptosis-regulating gene expression in photodynamic therapy-resistant variants of HT29 colon carcinoma cells.
15491618 2004 Solution structure and heparin interaction of human hepatoma-derived growth factor.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15017145 2004 Sequence specific 1H, 13C and 15N resonance assignments of the hath-domain of human hepatoma-derived growth factor.
14751852 2004 Hepatoma-derived growth factor is a pulmonary endothelial cell-expressed angiogenic factor.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14535987 2003 Expression of hepatoma-derived growth factor in hepatocarcinogenesis.
12972397 2004 Hepatoma-derived growth factor is involved in lung remodeling by stimulating epithelial growth.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11751870 2002 Hepatoma-derived growth factor stimulates cell growth after translocation to the nucleus by nuclear localization signals.
8833162 1996 Mapping of the gene encoding the human hepatoma-derived growth factor (HDGF) with homology to the high-mobility group (HMG)-1 protein to Xq25.
7929202 1994 Molecular cloning of complementary DNA for a novel human hepatoma-derived growth factor. Its homology with high mobility group-1 protein.