Property Summary

NCBI Gene PubMed Count 6
PubMed Score 6.93
PubTator Score 2.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Multiple myeloma 1.775 3.6e-03
malignant mesothelioma -1.200 2.3e-05
ependymoma -1.200 2.7e-02
astrocytoma -1.100 4.3e-02
glioblastoma -1.200 3.3e-03
hereditary spastic paraplegia -1.106 1.9e-03
intraductal papillary-mucinous carcinoma... -1.100 6.2e-03
intraductal papillary-mucinous neoplasm ... -1.800 6.0e-04
lung cancer 2.400 8.5e-04
ovarian cancer 2.700 2.0e-06

Synonym

Accession Q7Z4H3 Q5TDQ4 Q6NZ49 Q9BTT2 Q9BV31 Q9Y3D1
Symbols C6orf74
CGI-130
NS5ATP2
dJ167O5.2

Gene

PDB

4DMB   4L1J   4L7E   4L7W  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

PMID Text
22190034 HIV-1 IN is identified to have a physical interaction with HD domain containing 2 (HDDC2) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MASVSSATFSGHGARSLLQFLRLVGQLKRVPRTGWVYRNVQRPESVSDHMYRMAVMAMVIKDDRLNKDRC      1 - 70
VRLALVHDMAECIVGDIAPADNIPKEEKHRREEEAMKQITQLLPEDLRKELYELWEEYETQSSAEAKFVK     71 - 140
QLDQCEMILQASEYEDLEHKPGRLQDFYDSTAGKFNHPEIVQLVSELEAERSTNIAAAASEPHS          141 - 204
//

Text Mined References (12)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22190034 2011 Global landscape of HIV-human protein complexes.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15188496 2004 Cloning and identification of NS5ATP2 gene and its spliced variant transactivated by hepatitis C virus non-structural protein 5A.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10810093 2000 Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.