Property Summary

NCBI Gene PubMed Count 86
PubMed Score 240.61
PubTator Score 558.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma -1.700 1.1e-07
astrocytic glioma -1.600 1.8e-02
ependymoma -1.700 2.4e-02
oligodendroglioma -1.800 1.2e-02
osteosarcoma 1.226 4.3e-03
glioblastoma -2.400 1.9e-04
cystic fibrosis 1.594 4.7e-06
atypical teratoid / rhabdoid tumor -2.300 2.8e-04
medulloblastoma -1.500 2.0e-02
medulloblastoma, large-cell -2.600 4.4e-03
primitive neuroectodermal tumor -1.800 3.6e-02
tuberculosis 1.800 3.9e-06
intraductal papillary-mucinous neoplasm ... 2.600 1.4e-02
lung cancer 3.900 4.2e-06
interstitial cystitis 1.100 5.5e-03
adult high grade glioma -1.600 3.9e-02
pulmonary arterial hypertension -1.400 3.9e-02
lung carcinoma 1.600 4.6e-18

Protein-protein Interaction (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
651909 confirmatory 0 / 0 / 1 ML327 E-Cadherin HDAC Spectrum Assay_HDAC9

Gene RIF (50)

PMID Text
27033599 HDAC9 was commonly expressed in retinoblastoma tissues and HDAC9 was overexpressed in prognostically poor retinoblastoma patients.
26420860 Data suggest, in chronic hepatitis C virus infection, HDAC9 (histone deacetylase 9) induction in liver regulates hepatic gluconeogenesis and systemic insulin resistance via deacetylation of FoxO1 (Forkhead box O 1) and HDAC3 (histone deacetylase 3).
26347468 Polymorphisms of HDAC9 is associated with Ischemic Stroke.
26093197 results indicate that HDAC9 variant rs2107595 may be not associated with IS risk in southern Han Chinese
26084607 the results of this study suggest that targeting HDACs by ST-3595 might represent as a novel and promising anti-pancreatic cancer strategy.
25760078 HDAC9 promotes tumor formation of glioblastoma via TAZ-mediated EGFR pathway activation.
25613642 Data show that miR-376a and HDAC9 expression are inversely correlated in hepatocellular carcinoma and suggest that HDAC9-mediated epigenetic modification may contribute to the down-regulation of the miR-376 cluster in hepatocellular carcinoma.
25388417 Gene expression studies in peripheral blood mononuclear cells revealed increased mRNA levels of HDAC9. Analysis of human atherosclerotic plaques revealed no association between rs2107595 and specific plaque characteristics.
24650256 The results elucidate the genetic etiology of lung adenocarcinoma by demonstrating that SNP rs10248565 in the HDAC9 gene may be a potential biomarker of cancer susceptibility.
24562770 The hydroxamic acid pan-HDAC inhibitor TSA synergistically inhibit the viability.
24427341 These results suggest that HDAC9 may be a suppressor and its downregulation might promote the progression process, especially in lung adenocarcinomas.
23828597 HDAC9 gene is significantly associated with large-vessel stroke risk in Chinese population.
23784969 These data suggest that HDAC9 variants may be selected for during cutaneous squamous cell carcinoma tumorigenesis
23771909 study reports gene expression in skeletal muscle tissue of women with metabolic syndrome is enriched in inflammatory response-related genes; IL6R, HDAC9 and CD97 expression correlated negatively with insulin sensitivity; suggests a role for these 3 inflammatory genes in development of skeletal muscle insulin resistance in women
23674352 In vivo sorafenib + HDAC inhibitor toxicity against tumors was increased.
23449258 Our results are consistent with the 7p21.1 association acting via promoting atherosclerosis, and consistent with alterations in HDAC9 expression mediating this increased risk.
23393555 SNP, rs12155400, in the histone deacetylase 9 gene (HDAC9) on chromosome 7, was associated with retinopathy in analysis of participants without hypertension
23297420 Dephosphorylation at a conserved SP motif governs cAMP sensitivity and nuclear localization of class IIa histone deacetylases HDAC4, 5 and 9
23288173 HDAC9 promotes angiogenesis and transcriptionally represses the endothelial cell miR-17-92 cluster.
22945647 We propose that CtBP2 is an ovarian cancer oncogene that regulates gene expression program by modulating HDAC activity.
22884548 Regression models consistently identified rs2522129, rs2675231, and rs2389963 as having among the highest predictive values for explaining differences related to brain volume measures
22487525 LBH589 and TSA may translationally regulate some HDAC encoding genes in pancreatic tumors.
22306652 We identified a new association for large vessel stroke within HDAC9 on chromosome 7p21.1.
22297573 The results imply that HDAC9 is involved in the transcriptional regulation of human odontoblasts in vivo.
22032556 The results show that hdac9 is the third androgenic alopecia susceptibility gene
21987446 Treated the seminoma-like cell line TCam-2 with the HDAC-inhibitor Depsipeptide.
21806350 Data indicate a pronounced deregulation of HDAC genes HDAC9 and HDAC11 in patients with Philadelphia-negative chronic myeloproliferative neoplasms: essential thrombocythemia (ET), polycythemia vera (PV) and primary myelofibrosis (PMF).
21708950 HDAC9 acts as an epigenetic switch in effector T cell-mediated systemic autoimmunity.
21247904 MITR plays a master switch role to balance osteogenic and adipogenic differentiation of MSCs through regulation of PPARgamma-2 transcriptional activity.
21247901 Histone deacetylases 9 and 10 are required for homologous recombination.
21078662 enforced HDAC9 expression increased gamma-globin mRNA levels by 2.5-fold with a simultaneous 7-fold increase in HbF.
20947501 Histone deacetylase 9 (HDAC9) regulates the functions of the ATDC (TRIM29) protein
20844743 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20298200 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20031566 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19723072 Results demonstrate that histone deacetylase inhibitors (HDACIs) in different combinations with RA, act as cell growth inhibitors.
19624894 HDAC suppresses the activation of PPARgamma in the gastric carcinoma cell line SGC-7901.
19522008 Analysis of chromatin modification patterns shows that HDAC are recruited to the c-myc promoter leading to appearance of repressive chromatin marks.
18549475 Observational study of gene-disease association. (HuGE Navigator)
18438919 amino enhancer of split has apoptotic activity in neurons and suggest that neuroprotection by histone deacetylase-related protein is mediated by the inhibition of this activity through direct interaction.
17980413 Endogenous HDAC activity plays a crucial role in maintaining the balance of pre-established T(H)1-like and T(H)2-like responses, inhibiting excessive T(H)2 immunity.
17360565 FOXP3 interactions with histone acetyltransferase and class II histone deacetylases are required for repression
16980305 The role of ACTN4 in MEF2A transcription via HDAC7 antagonism is reported.
16399788 Moraxella catarrhalis-induced cytokine expression is regulated by acetylation of histone residues and controlled by histone deacetylase activity.
15567413 The crystal structure of a histone deacetylase 9 (HDAC9)/myocyte enhancer factor-2 (MEF2)/DNA complex reveals that HDAC9 binds to a hydrophobic groove of the MEF2 dimer.
15194749 ICP0 of Herpes simplex virus Type 1 interacts with and controls the repressor activity of class II HDAC7
12054582 Chromosomal organization on chromsome 7

AA Sequence

MHSMISSVDVKSEVPVGLEPISPLDLRTDLRMMMPVVDPVVREKQLQQELLLIQQQQQIQKQLLIAEFQK      1 - 70
QHENLTRQHQAQLQEHIKELLAIKQQQELLEKEQKLEQQRQEQEVERHRREQQLPPLRGKDRGRERAVAS     71 - 140
TEVKQKLQEFLLSKSATKDTPTNGKNHSVSRHPKLWYTAAHHTSLDQSSPPLSGTSPSYKYTLPGAQDAK    141 - 210
DDFPLRKTASEPNLKVRSRLKQKVAERRSSPLLRRKDGNVVTSFKKRMFEVTESSVSSSSPGSGPSSPNN    211 - 280
GPTGSVTENETSVLPPTPHAEQMVSQQRILIHEDSMNLLSLYTSPSLPNITLGLPAVPSQLNASNSLKEK    281 - 350
QKCETQTLRQGVPLPGQYGGSIPASSSHPHVTLEGKPPNSSHQALLQHLLLKEQMRQQKLLVAGGVPLHP    351 - 420
QSPLATKERISPGIRGTHKLPRHRPLNRTQSAPLPQSTLAQLVIQQQHQQFLEKQKQYQQQIHMNKLLSK    421 - 490
SIEQLKQPGSHLEEAEEELQGDQAMQEDRAPSSGNSTRSDSSACVDDTLGQVGAVKVKEEPVDSDEDAQI    491 - 560
QEMESGEQAAFMQQPFLEPTHTRALSVRQAPLAAVGMDGLEKHRLVSRTHSSPAASVLPHPAMDRPLQPG    561 - 630
SATGIAYDPLMLKHQCVCGNSTTHPEHAGRIQSIWSRLQETGLLNKCERIQGRKASLEEIQLVHSEHHSL    631 - 700
LYGTNPLDGQKLDPRILLGDDSQKFFSSLPCGGLGVDSDTIWNELHSSGAARMAVGCVIELASKVASGEL    701 - 770
KNGFAVVRPPGHHAEESTAMGFCFFNSVAITAKYLRDQLNISKILIVDLDVHHGNGTQQAFYADPSILYI    771 - 840
SLHRYDEGNFFPGSGAPNEVGTGLGEGYNINIAWTGGLDPPMGDVEYLEAFRTIVKPVAKEFDPDMVLVS    841 - 910
AGFDALEGHTPPLGGYKVTAKCFGHLTKQLMTLADGRVVLALEGGHDLTAICDASEACVNALLGNELEPL    911 - 980
AEDILHQSPNMNAVISLQKIIEIQSMSLKFS                                           981 - 1011
//

Text Mined References (88)

PMID Year Title
27033599 2016 Downregulation of HDAC9 inhibits cell proliferation and tumor formation by inducing cell cycle arrest in retinoblastoma.
26420860 2015 The Metabolic Regulator Histone Deacetylase 9 Contributes to Glucose Homeostasis Abnormality Induced by Hepatitis C Virus Infection.
26347468 2016 Association Between the Gene Polymorphisms of HDAC9 and the Risk of Atherosclerosis and Ischemic Stroke.
26093197 2015 Association of GWAS-supported loci rs2107595 in HDAC9 gene with ischemic stroke in southern Han Chinese.
26084607 2015 Targeting pancreatic cancer cells by a novel hydroxamate-based histone deacetylase (HDAC) inhibitor ST-3595.
25760078 2015 HDAC9 promotes glioblastoma growth via TAZ-mediated EGFR pathway activation.
25613642 2015 MiR-376a and histone deacetylation 9 form a regulatory circuitry in hepatocellular carcinoma.
25388417 2015 Deficiency of the stroke relevant HDAC9 gene attenuates atherosclerosis in accord with allele-specific effects at 7p21.1.
25256182 2014 Genome-wide association study of intracranial aneurysm identifies a new association on chromosome 7.
24650256 2014 SNP rs10248565 in HDAC9 as a novel genomic aberration biomarker of lung adenocarcinoma in non-smoking women.
24562770 2014 mTORC1/C2 and pan-HDAC inhibitors synergistically impair breast cancer growth by convergent AKT and polysome inhibiting mechanisms.
24554482 2014 Genome-wide association study of peripheral neuropathy with D-drug-containing regimens in AIDS Clinical Trials Group protocol 384.
24427341 2014 Expression of HDAC9 in lung cancer--potential role in lung carcinogenesis.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
24262325 2014 Shared genetic susceptibility to ischemic stroke and coronary artery disease: a genome-wide analysis of common variants.
23828597 2013 HDAC9 gene is associated with stroke risk in a Chinese population.
23784969 2014 Allele-specific imbalance mapping identifies HDAC9 as a candidate gene for cutaneous squamous cell carcinoma.
23771909 2013 Upregulation of skeletal muscle inflammatory genes links inflammation with insulin resistance in women with the metabolic syndrome.
23674352 2013 Sorafenib and HDAC inhibitors synergize with TRAIL to kill tumor cells.
23449258 2013 Evidence HDAC9 genetic variant associated with ischemic stroke increases risk via promoting carotid atherosclerosis.
23393555 2013 Genome-wide association study of retinopathy in individuals without diabetes.
23297420 2013 Dephosphorylation at a conserved SP motif governs cAMP sensitivity and nuclear localization of class IIa histone deacetylases.
23288173 2013 Histone deacetylase 9 promotes angiogenesis by targeting the antiangiogenic microRNA-17-92 cluster in endothelial cells.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23041239 2012 Genetic risk factors for ischaemic stroke and its subtypes (the METASTROKE collaboration): a meta-analysis of genome-wide association studies.
22945647 2013 C-terminal binding protein-2 regulates response of epithelial ovarian cancer cells to histone deacetylase inhibitors.
22884548 2013 Histone deacetylase gene variants predict brain volume changes in multiple sclerosis.
22693459 2012 Six novel susceptibility Loci for early-onset androgenetic alopecia and their unexpected association with common diseases.
22487525 HDAC gene expression in pancreatic tumor cell lines following treatment with the HDAC inhibitors panobinostat (LBH589) and trichostatine (TSA).
22306652 2012 Genome-wide association study identifies a variant in HDAC9 associated with large vessel ischemic stroke.
22297573 2012 Histone deacetylases 2 and 9 are coexpressed and nuclear localized in human molar odontoblasts in vivo.
22032556 2011 Susceptibility variants on chromosome 7p21.1 suggest HDAC9 as a new candidate gene for male-pattern baldness.
21987446 2011 The seminoma cell line TCam-2 is sensitive to HDAC inhibitor depsipeptide but tolerates various other chemotherapeutic drugs and loss of NANOG expression.
21806350 2012 Increased gene expression of histone deacetylases in patients with Philadelphia-negative chronic myeloproliferative neoplasms.
21708950 2011 Histone deacetylase 9 deficiency protects against effector T cell-mediated systemic autoimmunity.
21248752 2011 Exome sequencing identifies frequent mutation of the SWI/SNF complex gene PBRM1 in renal carcinoma.
21247904 2011 Myocyte enhancer factor-2 interacting transcriptional repressor (MITR) is a switch that promotes osteogenesis and inhibits adipogenesis of mesenchymal stem cells by inactivating peroxisome proliferator-activated receptor gamma-2.
21247901 2011 Histone deacetylases 9 and 10 are required for homologous recombination.
21078662 2011 Histone deacetylase 9 activates gamma-globin gene expression in primary erythroid cells.
20947501 2010 Histone deacetylase 9 (HDAC9) regulates the functions of the ATDC (TRIM29) protein.
20848476 2010 Genetic predictors of medically refractory ulcerative colitis.
20844743 2010 Single nucleotide polymorphisms in the Wnt and BMP pathways and colorectal cancer risk in a Spanish cohort.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20298200 2010 Confirmed rare copy number variants implicate novel genes in schizophrenia.
20188095 2010 Protein kinase C-related kinase targets nuclear localization signals in a subset of class IIa histone deacetylases.
20031566 2009 Association of regions on chromosomes 6 and 7 with blood pressure in Nigerian families.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19723072 2009 Response of retinoic acid-resistant KG1 cells to combination of retinoic acid with diverse histone deacetylase inhibitors.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19624894 2009 [Role of histone deacetylase in inhibiting invasion of human gastric carcinoma cell line SGC-7901 by PPARgamma-mediated pathway].
19522008 2009 Gfi-1B promoter remains associated with active chromatin marks throughout erythroid differentiation of human primary progenitor cells.
19351956 2009 HDAC5 is a repressor of angiogenesis and determines the angiogenic gene expression pattern of endothelial cells.
19303849 2009 A role of DNA-PK for the metabolic gene regulation in response to insulin.
18549475 2008 Genome wide SNP comparative analysis between EGFR and KRAS mutated NSCLC and characterization of two models of oncogenic cooperation in non-small cell lung carcinoma.
18438919 2008 Histone deacetylase-related protein inhibits AES-mediated neuronal cell death by direct interaction.
17980413 2008 Epigenetic regulation of established human type 1 versus type 2 cytokine responses.
17360565 2007 FOXP3 interactions with histone acetyltransferase and class II histone deacetylases are required for repression.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16980305 2006 Alpha-actinin 4 potentiates myocyte enhancer factor-2 transcription activity by antagonizing histone deacetylase 7.
16611996 2006 Neuroprotection by histone deacetylase-related protein.
16399788 2006 Moraxella catarrhalis induces inflammatory response of bronchial epithelial cells via MAPK and NF-kappaB activation and histone deacetylase activity reduction.
16147992 2005 Analysis of BCL6-interacting proteins by tandem mass spectrometry.
15567413 2005 Mechanism of recruitment of class II histone deacetylases by myocyte enhancer factor-2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15194749 2004 Functional interaction between class II histone deacetylases and ICP0 of herpes simplex virus type 1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14684825 2003 Genome-wide survey of human alternative pre-mRNA splicing with exon junction microarrays.
12853948 2003 The DNA sequence of human chromosome 7.
12711221 2003 Class II histone deacetylases: versatile regulators.
12706107 2003 Molecular characterization of a familial translocation implicates disruption of HDAC9 and possible position effect on TGFbeta2 in the pathogenesis of Peters' anomaly.
12590135 2003 The histone deacetylase 9 gene encodes multiple protein isoforms.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12242305 2002 Association of class II histone deacetylases with heterochromatin protein 1: potential role for histone methylation in control of muscle differentiation.
12054582 2002 Chromosomal organization and localization of the human histone deacetylase 9 gene (HDAC9).
12032081 2002 The SUMO E3 ligase RanBP2 promotes modification of the HDAC4 deacetylase.
11535832 2001 Cloning and characterization of a histone deacetylase, HDAC9.
11466315 2001 Human HDAC7 histone deacetylase activity is associated with HDAC3 in vivo.
11022042 2001 Association of COOH-terminal-binding protein (CtBP) and MEF2-interacting transcription repressor (MITR) contributes to transcriptional repression of the MEF2 transcription factor.
10922406 2000 Histone deacetylase inhibitors: inducers of differentiation or apoptosis of transformed cells.
10825153 2000 Calcium regulates transcriptional repression of myocyte enhancer factor 2 by histone deacetylase 4.
10748098 2000 mHDA1/HDAC5 histone deacetylase interacts with and represses MEF2A transcriptional activity.
10655483 2000 Identification of a transcriptional repressor related to the noncatalytic domain of histone deacetylases 4 and 5.
10523670 1999 HDAC4, a human histone deacetylase related to yeast HDA1, is a transcriptional corepressor.
10487761 1999 HDAC4 deacetylase associates with and represses the MEF2 transcription factor.
10487760 1999 MEF-2 function is modified by a novel co-repressor, MITR.
9872452 1998 Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
9847074 1998 Toward a complete human genome sequence.