Property Summary

NCBI Gene PubMed Count 76
PubMed Score 100.31
PubTator Score 75.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Inflammatory Bowel Diseases 87
Disease Target Count P-value
osteosarcoma 7933 1.7e-03
Disease Target Count Z-score Confidence
Crohn's disease 304 0.0 2.0
Disease Target Count Z-score Confidence
Cancer 2346 3.179 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.257 1.7e-03

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
651907 confirmatory 0 / 0 / 1 ML327 E-Cadherin HDAC Spectrum Assay_HDAC7

Gene RIF (45)

PMID Text
26469385 HIV-1 MA downregulates HDAC7 gene expression in HepG2 cells
26272600 This study demonstrated a simple and straightforward method of quantifying proneural/mesenchymal markers in glioblastoma. Of note, HDAC7 expression might be a novel therapeutic target in glioblastoma treatment.
25511694 identify a new target of ROCK signaling via myosin phosphatase subunit (MYPT1) and histone deacetylase (HDAC7) at the nuclear level
25173798 Study identifies the miR-34a-HDAC1/HDAC7-HSP70 K246 axis as a novel molecular signature predictive of therapy resistance.
24239178 The transcriptional function of HCS was shown by in vitro pull down and in vivo co-immunoprecipitation assays to depend on its interaction with the histone deacetylases HDAC1, HDAC2 and HDAC7
24189120 endothelial progenitor cells involved in the angiogenesis might be controlled by VEGF-PKD1-HDAC7 axis, which regulates the EPCs angiogenesis by PKD1, but not the ERK and PI3K pathway
23891737 Expression of JHDM2A was significantly increased but HDAC2, HDAC7, and SUV39H2 were significantly down-regulated in Systemic Sclerosis B cells relative to controls
23880157 Authors identified acetyltransferase p300 and deacetylase HDAC7 as enzymes modulating human T cell leukemia virus type 1 Tax protein acetylation.
23853092 Histone deacetylase 7 promotes Toll-like receptor 4-dependent proinflammatory gene expression in macrophages.
23696748 Our findings uncover a novel role for HDAC7 in maintaining the identity of a particular cell type by silencing lineage-inappropriate genes.
23401860 VEGF and PKC promote degradation-independent protein ubiquitination of FLNB to control intracellular trafficking of HDAC7.
22584896 demonstrated for the first time that AKAP12 tumor/angiogenesis suppressor gene is an epigenetic target of HDAC7
22172637 HDAC7 reduction in COPD causes a defect of HIF-1alpha induction response to hypoxia with impaired VEGF gene expression. This poor cellular adaptation might play a role in the pathogenesis of COPD.
21324898 Data demonstrate that Mitf and HDAC7 interact in RAW 264 cells and osteoclasts. The transcriptional activity of Mitf is repressed by HDAC7.
21120446 Findings highlight for the first time an unrecognized link between HDAC7 and c-Myc and offer a novel mechanistic insight into the contribution of HDAC7 to tumor progression.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20693714 The expression of HDAC7 protein plays an important role in the apoptosis and vascular tubulogenesis of hepatocellular carcinoma by the upregulation of p21 and HIF-1alpha and the downregulation of cyclin E and MMP10.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20224040 HDAC7 interacts with beta-catenin keeping endothelial cells in a low proliferation stage.
19966789 histone deacetylase 7 has a role in function of misfolded CFTR in cystic fibrosis
19917725 these data implicate a novel role for HDAC7 and FoxA1 in estrogen repression of RPRM.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19784544 Elevated HDAC7 expression in human osteoarthritis may contribute to cartilage degradation via promoting MMP-13 gene expression.
19355988 recent developments in the crystal structure analysis of human HDAC4, HDAC7, and HDAC8 recent developments in the crystal structure analysis of human HDAC4, HDAC7, and HDAC8 [REVIEW]
19240061 Observational study of gene-disease association. (HuGE Navigator)
18625722 These results demonstrate a novel function of HDAC7 and provide a regulatory mechanism of PML sumoylation.
18617643 VEGF stimulates HDAC7 phosphorylation and cytoplasmic accumulation modulating MT-MMP1/MMP10 expression and angiogenesis.
18509061 These results demonstrate that phosphorylation of HDAC7 serves as a molecular switch to mediate VEGF signaling and endothelial function.
18506539 The data showed alteration of HDACs gene expression in pancreatic cancer. Increased expression of HDAC7 discriminates PA from other pancreatic tumors.
18463162 PML sequesters HDAC7 to relieve repression and up-regulate gene expression
18458084 Caspase-8 cleaves histone deacetylase 7 and abolishes its transcription repressor function.
18339811 PP2A constitutively dephosphorylates the class IIa member HDAC7 to control its biological functions as a regulator of T cell apoptosis and endothelial cell functions.
18285338 HDAC7 has a class IIa histone deacetylase-specific zinc binding motif and cryptic deacetylase activity
17997710 Histone deacetylase 7 associates with Runx2 and represses its activity during osteoblast maturation in a deacetylation-independent manner
17947801 HDAC7 is a key modulator of endothelial cell migration and angiogenesis, at least in part, by regulating platelet-derived growth factor-B (PDGF-B) and its receptor PDGFR-beta gene expression.
16980613 Class IIa histone deacetylases (HDACs) are subjected to signal-independent nuclear export that relies on their constitutive phosphorylation. EMK and C-TAK1, are identified as regulators of this process.
16860317 These results identify HDAC7 as a novel Androgen receptor corepressor whose subcellular and subnuclear compartmentalization can be regulated in an androgen-selective manner.
15738054 a mutant of HDAC7 specifically deficient in phosphorylation by protein kinase D, inhibits T cell receptor-mediated apoptosis of T cell hybridomas
15623513 Data indicate that protein kinase D1 regulates the expression of Nur77 during thymocyte activation at least in part by phosphorylating HDAC7.
15364908 HDAC7 is sequestered to the cytoplasm from mitochondrial and nuclear compartments upon initiation of apoptosis
15280364 HDAC7 increased transcriptional activity of HIF-1alpha through the formation of a complex with HIF-1alpha, HDAC7, and p300
15166223 HDAC7 phosphorylation is mediated by calcium/calmodulin-dependent kinase I, which also promotes the association of HDAC7 with 14-3-3 and stabilizes HDAC7
12753745 Interaction of HDAC7 with MEF2D is essential for repression of Nur77.
11929873 Class II histone deacetylases are directly recruited by BCL6 transcriptional repressor
10640276 Characterization of the mouse HDAC7 ortholog.

AA Sequence

MDLRVGQRPPVEPPPEPTLLALQRPQRLHHHLFLAGLQQQRSVEPMRLSMDTPMPELQVGPQEQELRQLL      1 - 70
HKDKSKRSAVASSVVKQKLAEVILKKQQAALERTVHPNSPGIPYRTLEPLETEGATRSMLSSFLPPVPSL     71 - 140
PSDPPEHFPLRKTVSEPNLKLRYKPKKSLERRKNPLLRKESAPPSLRRRPAETLGDSSPSSSSTPASGCS    141 - 210
SPNDSEHGPNPILGSEALLGQRLRLQETSVAPFALPTVSLLPAITLGLPAPARADSDRRTHPTLGPRGPI    211 - 280
LGSPHTPLFLPHGLEPEAGGTLPSRLQPILLLDPSGSHAPLLTVPGLGPLPFHFAQSLMTTERLSGSGLH    281 - 350
WPLSRTRSEPLPPSATAPPPPGPMQPRLEQLKTHVQVIKRSAKPSEKPRLRQIPSAEDLETDGGGPGQVV    351 - 420
DDGLEHRELGHGQPEARGPAPLQQHPQVLLWEQQRLAGRLPRGSTGDTVLLPLAQGGHRPLSRAQSSPAA    421 - 490
PASLSAPEPASQARVLSSSETPARTLPFTTGLIYDSVMLKHQCSCGDNSRHPEHAGRIQSIWSRLQERGL    491 - 560
RSQCECLRGRKASLEELQSVHSERHVLLYGTNPLSRLKLDNGKLAGLLAQRMFVMLPCGGVGVDTDTIWN    561 - 630
ELHSSNAARWAAGSVTDLAFKVASRELKNGFAVVRPPGHHADHSTAMGFCFFNSVAIACRQLQQQSKASK    631 - 700
ILIVDWDVHHGNGTQQTFYQDPSVLYISLHRHDDGNFFPGSGAVDEVGAGSGEGFNVNVAWAGGLDPPMG    701 - 770
DPEYLAAFRIVVMPIAREFSPDLVLVSAGFDAAEGHPAPLGGYHVSAKCFGYMTQQLMNLAGGAVVLALE    771 - 840
GGHDLTAICDASEACVAALLGNRVDPLSEEGWKQKPNLNAIRSLEAVIRVHSKYWGCMQRLASCPDSWVP    841 - 910
RVPGADKEEVEAVTALASLSVGILAEDRPSEQLVEEEEPMNL                                911 - 952
//

Text Mined References (86)

PMID Year Title
26272600 2015 Detection of proneural/mesenchymal marker expression in glioblastoma: temporospatial dynamics and association with chromatin-modifying gene expression.
25511694 2015 Rho-kinase signaling controls nucleocytoplasmic shuttling of class IIa histone deacetylase (HDAC7) and transcriptional activation of orphan nuclear receptor NR4A1.
25416956 2014 A proteome-scale map of the human interactome network.
25411248 2015 ?-Actinin 4 potentiates nuclear factor ?-light-chain-enhancer of activated B-cell (NF-?B) activity in podocytes independent of its cytoplasmic actin binding function.
25173798 2014 MiR-34a regulates therapy resistance by targeting HDAC1 and HDAC7 in breast cancer.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24239178 2014 Holocarboxylase synthetase acts as a biotin-independent transcriptional repressor interacting with HDAC1, HDAC2 and HDAC7.
24189120 2014 VEGF-PKD1-HDAC7 signaling promotes endothelial progenitor cell migration and tube formation.
23891737 2013 Aberrant histone modification in peripheral blood B cells from patients with systemic sclerosis.
23880157 2013 Acetylation at lysine 346 controls the transforming activity of the HTLV-1 Tax oncoprotein in the Rat-1 fibroblast model.
23853092 2013 Histone deacetylase 7 promotes Toll-like receptor 4-dependent proinflammatory gene expression in macrophages.
23752268 2013 The functional interactome landscape of the human histone deacetylase family.
23696748 2013 HDAC7 is a repressor of myeloid genes whose downregulation is required for transdifferentiation of pre-B cells into macrophages.
23401860 2013 Monoubiquitination of filamin B regulates vascular endothelial growth factor-mediated trafficking of histone deacetylase 7.
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22584896 2012 The angiogenesis suppressor gene AKAP12 is under the epigenetic control of HDAC7 in endothelial cells.
22172637 2012 Defect of adaptation to hypoxia in patients with COPD due to reduction of histone deacetylase 7.
22155184 2012 ?-catenin inhibits promyelocytic leukemia protein tumor suppressor function in colorectal cancer cells.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21324898 2011 HDAC3 and HDAC7 have opposite effects on osteoclast differentiation.
21120446 2011 The role of histone deacetylase 7 (HDAC7) in cancer cell proliferation: regulation on c-Myc.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20693714 2010 [RNA interference of HDAC7 expression in hepatocellular carcinoma].
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20590529 2010 Dual roles for MEF2A and MEF2D during human macrophage terminal differentiation and c-Jun expression.
20224040 2010 Histone deacetylase 7 controls endothelial cell growth through modulation of beta-catenin.
20188095 2010 Protein kinase C-related kinase targets nuclear localization signals in a subset of class IIa histone deacetylases.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19966789 2010 Reduced histone deacetylase 7 activity restores function to misfolded CFTR in cystic fibrosis.
19917725 2010 Histone deacetylase 7 and FoxA1 in estrogen-mediated repression of RPRM.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19784544 2010 Correlation between MMP-13 and HDAC7 expression in human knee osteoarthritis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19355988 2009 Novel structural insights into class I and II histone deacetylases.
19351956 2009 HDAC5 is a repressor of angiogenesis and determines the angiogenic gene expression pattern of endothelial cells.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18625722 2008 Histone deacetylase 7 promotes PML sumoylation and is essential for PML nuclear body formation.
18617643 2008 VEGF stimulates HDAC7 phosphorylation and cytoplasmic accumulation modulating matrix metalloproteinase expression and angiogenesis.
18509061 2008 Control of endothelial cell proliferation and migration by VEGF signaling to histone deacetylase 7.
18506539 2008 High histone deacetylase 7 (HDAC7) expression is significantly associated with adenocarcinomas of the pancreas.
18463162 2008 Signal-dependent regulation of transcription by histone deacetylase 7 involves recruitment to promyelocytic leukemia protein nuclear bodies.
18458084 2008 Caspase-8 cleaves histone deacetylase 7 and abolishes its transcription repressor function.
18339811 2008 Protein phosphatase 2A controls the activity of histone deacetylase 7 during T cell apoptosis and angiogenesis.
18285338 2008 Human HDAC7 harbors a class IIa histone deacetylase-specific zinc binding motif and cryptic deacetylase activity.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17997710 2008 Histone deacetylase 7 associates with Runx2 and represses its activity during osteoblast maturation in a deacetylation-independent manner.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17962809 2007 Phosphorylation at Ser244 by CK1 determines nuclear localization and substrate targeting of PKD2.
17947801 2007 Histone deacetylase 7 silencing alters endothelial cell migration, a key step in angiogenesis.
17373667 2007 Breast cancer associated transcriptional repressor PLU-1/JARID1B interacts directly with histone deacetylases.
17360565 2007 FOXP3 interactions with histone acetyltransferase and class II histone deacetylases are required for repression.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16980613 2006 New role for hPar-1 kinases EMK and C-TAK1 in regulating localization and activity of class IIa histone deacetylases.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16860317 2006 Androgen receptor regulates nuclear trafficking and nuclear domain residency of corepressor HDAC7 in a ligand-dependent fashion.
16541075 2006 The finished DNA sequence of human chromosome 12.
15778465 2005 Targeted proteomic analysis of 14-3-3 sigma, a p53 effector commonly silenced in cancer.
15738054 2005 Phosphorylation of histone deacetylase 7 by protein kinase D mediates T cell receptor-induced Nur77 expression and apoptosis.
15623513 2005 Protein kinase D1 phosphorylates HDAC7 and induces its nuclear export after T-cell receptor activation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15364908 2004 Cytoplasmic sequestration of HDAC7 from mitochondrial and nuclear compartments upon initiation of apoptosis.
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15280364 2004 Histone deacetylase 7 associates with hypoxia-inducible factor 1alpha and increases transcriptional activity.
15194749 2004 Functional interaction between class II histone deacetylases and ICP0 of herpes simplex virus type 1.
15166223 2004 Phosphorylation of the histone deacetylase 7 modulates its stability and association with 14-3-3 proteins.
15161933 2004 Comprehensive proteomic analysis of interphase and mitotic 14-3-3-binding proteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12970571 2003 Transcriptional repression of atherogenic inflammation: modulation by PPARdelta.
12753745 2003 HDAC7, a thymus-specific class II histone deacetylase, regulates Nur77 transcription and TCR-mediated apoptosis.
12711221 2003 Class II histone deacetylases: versatile regulators.
12551922 2003 Tip60 is a co-repressor for STAT3.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12239305 2002 Signal Transduction and Transcription Factor Modification during Reactivation of Epstein-Barr Virus from Latency.
11929873 2002 Class II histone deacetylases are directly recruited by BCL6 transcriptional repressor.
11466315 2001 Human HDAC7 histone deacetylase activity is associated with HDAC3 in vivo.
11262386 2001 Tip60 and HDAC7 interact with the endothelin receptor a and may be involved in downstream signaling.
10922406 2000 Histone deacetylase inhibitors: inducers of differentiation or apoptosis of transformed cells.
10640276 2000 Isolation of a novel histone deacetylase reveals that class I and class II deacetylases promote SMRT-mediated repression.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.