Property Summary

NCBI Gene PubMed Count 77
PubMed Score 127.61
PubTator Score 107.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 1.200 7.0e-06
ependymoma -1.300 1.7e-10
glioblastoma -1.100 2.2e-08
adult high grade glioma -1.500 1.4e-06
atypical teratoid/rhabdoid tumor -1.100 1.4e-06
subependymal giant cell astrocytoma -1.124 1.9e-02
non-inflammatory breast cancer -1.300 2.5e-04

Protein-protein Interaction (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
651915 confirmatory 0 / 0 / 1 ML327 E-Cadherin HDAC Spectrum Assay_HDAC5

Gene RIF (46)

PMID Text
26747087 HDAC5 and HDAC6 were highly expressed in melanoma cells but exhibited low expression levels in normal skin cells.
26261519 Formononetin-combined therapy may enhance the therapeutic efficacy of doxorubicin in glioma cells by preventing EMT through inhibition of HDAC5.
26059794 These results suggest a strong regulatory function of HDAC5 in the pro-inflammatory response of macrophages.
25129440 mRNA and protein levels of HDAC5 were up-regulated in human hepatocellular carcinoma.
25096223 Data reveal a novel role of HDAC5 in modulating the KLF2 transcriptional activation and eNOS expression.
24920159 Studied phosphorylation sites within functional HDAC5 domains, including the deacetylation domain (DAC, Ser755), nuclear export signal (NES, Ser1108), and an acidic domain (AD, Ser611).
24732133 In C2C12 myoblasts, recombinant human HDAC5 phosphorylation by PKD regulated the expression of diverse metabolic genes and glucose metabolism.
24706304 HDAC5 promoted the Six1 expression.
24594363 In erythroid cells, pull down experiments identified the presence of a novel complex formed by HDAC5, GATA1, EKLF and pERK which was instead undetectable in cells of the megakaryocytic lineage.
24191246 we show that Stat3 binds to the promoter region of PTPN13 and promotes its activity through recruiting HDAC5. Thus, our results suggest a previously unknown Stat3-PTPN13 molecular network controlling squamous cell lung carcinoma development
24120667 These findings suggest that HDAC5 is a key determinant of p53-mediated cell fate decisions in response to genotoxic stress.
24092570 At the molecular level, we demonstrated that HDAC5 promoted mRNA expression of twist 1, which has been reported as an oncogene
23812427 findings show N-Myc upregulated HDAC5 expression in neuroblastoma cells; HDAC5 repressed NEDD4 gene expression,increased Aurora A gene expression and consequently upregulated N-Myc protein expression;data identify HDAC5 as a novel co-factor in N-Myc oncogenesis
23729589 HDAC5 is essential for the length maintenance of long telomeres and its depletion is required for sensitization of cancer cells with long telomeres to chemotherapy.
23615070 Data indicate there was a link between baseline viral load, age (40 years), IL-28B (rs12979860), HDAC2 (rs3778216), HDAC3 (rs976552) and HDAC5 (rs368328) with sustained virological response (SVR).
23364788 Nuclear calcium signaling is a regulator of nuclear export of HDAC4 and HDAC5.
23297420 Dephosphorylation at a conserved SP motif governs cAMP sensitivity and nuclear localization of class IIa histone deacetylases HDAC4, 5 and 9
22991226 Data suggest that HDAC5 regulates muscle glucose metabolism and insulin action and that HDAC inhibitors can be used to modulate these parameters in muscle cells.
22941650 The current study identified the class II deacetylase HDAC5 as a novel promoting factor of CTG*CAG expansions.
22914591 Loss of HDAC5 impairs memory function but has little impact in a transgenic mouse model of amyloid pathology.
22301920 HDAC5 in the maintenance/assembly of pericentric heterochromatin structure and demonstrate that class IIa HDAC5 can represent a potential target for anticancer therapies.
22243750 The results of this study suggested that suggest that HDAC5 provides a delayed braking mechanism on gene expression programs that support the development, but not expression, of cocaine reward behaviors.
21508384 Significantly increased methylation of the HDAC5 gene was associated with astrocytomas.
21146494 in addition to activation of protein kinase D isozymes by phosphorylating Ser744 and Ser748 at their activation sites, PKCdelta may also play a role in the regulation of HDAC5 by phosphorylation of Ser259
21081666 Ser279 is a critical phosphorylation within the NLS involved in the nuclear import of HDAC5
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
21047791 differentiation-dependent GLUT4 gene expression in 3T3-L1 adipocytes is dependent on the nuclear concentration of a class II histone deacetylase (HDAC) protein, HDAC5
20716686 Findings identify HDAC5 as a substrate of PKA and reveal a cAMP/PKA-dependent pathway that controls HDAC5 nucleocytoplasmic shuttling and represses gene transcription.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20042720 phosphorylation-dependent derepression of HDAC5 mediates flow-induced KLF2 and eNOS expression as well as flow anti-inflammation, and suggest that HDAC5 could be a potential therapeutic target for the prevention of atherosclerosis.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19351956 HDAC5 represses angiogenic genes, such as FGF2 and Slit2, which causally contribute to capillary-like sprouting of endothelial cells.
19071119 These results indicate that HDAC4 and HDAC5 increase the transactivation function of HIF-1alpha by promoting dissociation of HIF-1alpha from FIH-1 and association with p300.
18332134 Protein kinase D-HDAC5 pathway plays an important role in VEGF regulation of gene transcription and angiogenesis
18288090 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18218981 Chronic upregulation/activation of CaMKIID, and PKD in heart failure shifts HDAC5 out of the nucleus, derepressing transcription of hypertrophic genes.
18184930 AMP-activated protein kinase (AMPK) regulates GLUT4 transcription through the histone deacetylase (HDAC)5 transcriptional repressor.
17975112 NO-dependent PP2A activation plays a key role in nuclear translocation of class II HDACs HDAC4 and HDAC5
16236793 novel transcriptional pathway under the control of class II HDACs and suggest a role for these transcriptional repressors as signal-responsive regulators of antigen presentation
16221676 G betagamma binds HDAC5 and inhibits its transcriptional co-repression activity
15590418 The HDAC5, a class II HDAC involved in myogenesis, was not detected in the tissues.
15194749 ICP0 of herpes simplex virus Type 1 is able to overcome the HDAC5 amino-terminal- and MITR-induced MEF2A repression in gene reporter assays
12626519 HDAC5 binds to Ca(2+)/calmodulin and inhibits MEF2a binding
12242305 MITR, HDAC4, and HDAC5 associate with heterochromatin protein 1 (HP1), an adaptor protein that recognizes methylated lysines within histone tails and mediates transcriptional repression by recruiting histone methyltransferase
12019172 Histone deacetylase 5 is not a p53 target gene, but its overexpression inhibits tumor cell growth and induces apoptosis.
11929873 Class II histone deacetylases are directly recruited by BCL6 transcriptional repressor

AA Sequence

MNSPNESDGMSGREPSLEILPRTSLHSIPVTVEVKPVLPRAMPSSMGGGGGGSPSPVELRGALVGSVDPT      1 - 70
LREQQLQQELLALKQQQQLQKQLLFAEFQKQHDHLTRQHEVQLQKHLKQQQEMLAAKQQQEMLAAKRQQE     71 - 140
LEQQRQREQQRQEELEKQRLEQQLLILRNKEKSKESAIASTEVKLRLQEFLLSKSKEPTPGGLNHSLPQH    141 - 210
PKCWGAHHASLDQSSPPQSGPPGTPPSYKLPLPGPYDSRDDFPLRKTASEPNLKVRSRLKQKVAERRSSP    211 - 280
LLRRKDGTVISTFKKRAVEITGAGPGASSVCNSAPGSGPSSPNSSHSTIAENGFTGSVPNIPTEMLPQHR    281 - 350
ALPLDSSPNQFSLYTSPSLPNISLGLQATVTVTNSHLTASPKLSTQQEAERQALQSLRQGGTLTGKFMST    351 - 420
SSIPGCLLGVALEGDGSPHGHASLLQHVLLLEQARQQSTLIAVPLHGQSPLVTGERVATSMRTVGKLPRH    421 - 490
RPLSRTQSSPLPQSPQALQQLVMQQQHQQFLEKQKQQQLQLGKILTKTGELPRQPTTHPEETEEELTEQQ    491 - 560
EVLLGEGALTMPREGSTESESTQEDLEEEDEEDDGEEEEDCIQVKDEEGESGAEEGPDLEEPGAGYKKLF    561 - 630
SDAQPLQPLQVYQAPLSLATVPHQALGRTQSSPAAPGGMKSPPDQPVKHLFTTGVVYDTFMLKHQCMCGN    631 - 700
THVHPEHAGRIQSIWSRLQETGLLSKCERIRGRKATLDEIQTVHSEYHTLLYGTSPLNRQKLDSKKLLGP    701 - 770
ISQKMYAVLPCGGIGVDSDTVWNEMHSSSAVRMAVGCLLELAFKVAAGELKNGFAIIRPPGHHAEESTAM    771 - 840
GFCFFNSVAITAKLLQQKLNVGKVLIVDWDIHHGNGTQQAFYNDPSVLYISLHRYDNGNFFPGSGAPEEV    841 - 910
GGGPGVGYNVNVAWTGGVDPPIGDVEYLTAFRTVVMPIAHEFSPDVVLVSAGFDAVEGHLSPLGGYSVTA    911 - 980
RCFGHLTRQLMTLAGGRVVLALEGGHDLTAICDASEACVSALLSVELQPLDEAVLQQKPNINAVATLEKV    981 - 1050
IEIQSKHWSCVQKFAAGLGRSLREAQAGETEEAETVSAMALLSVGAEQAQAAAAREHSPRPAEEPMEQEP   1051 - 1120
AL                                                                       1121 - 1122
//

Text Mined References (84)

PMID Year Title
26747087 2016 Both HDAC5 and HDAC6 are required for the proliferation and metastasis of melanoma cells.
26261519 2015 Formononetin sensitizes glioma cells to doxorubicin through preventing EMT via inhibition of histone deacetylase 5.
26059794 2015 Histone deacetylase 5 regulates the inflammatory response of macrophages.
25129440 2014 Down-regulation of HDAC5 inhibits growth of human hepatocellular carcinoma by induction of apoptosis and cell cycle arrest.
25096223 2014 Histone deacetylase 5 interacts with Krüppel-like factor 2 and inhibits its transcriptional activity in endothelium.
24920159 2014 Probing phosphorylation-dependent protein interactions within functional domains of histone deacetylase 5 (HDAC5).
24732133 2014 Compensatory regulation of HDAC5 in muscle maintains metabolic adaptive responses and metabolism in response to energetic stress.
24706304 2014 HDAC5 promotes cell proliferation in human hepatocellular carcinoma by up-regulating Six1 expression.
24594363 2014 Identification of NuRSERY, a new functional HDAC complex composed by HDAC5, GATA1, EKLF and pERK present in human erythroid cells.
24413532 2014 Differential regulation of estrogen receptor ? expression in breast cancer cells by metastasis-associated protein 1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24229708 2013 Runx3 inactivation is a crucial early event in the development of lung adenocarcinoma.
24191246 2013 Stat3 inhibits PTPN13 expression in squamous cell lung carcinoma through recruitment of HDAC5.
24120667 2013 HDAC5, a key component in temporal regulation of p53-mediated transactivation in response to genotoxic stress.
24092570 2014 HDAC5 promotes osteosarcoma progression by upregulation of Twist 1 expression.
23867755 2013 Involvement of Epac1/Rap1/CaMKI/HDAC5 signaling cascade in the regulation of placental cell fusion.
23812427 2014 Histone deacetylase 5 blocks neuroblastoma cell differentiation by interacting with N-Myc.
23752268 2013 The functional interactome landscape of the human histone deacetylase family.
23729589 2013 A new role for histone deacetylase 5 in the maintenance of long telomeres.
23615070 Polymorphisms in histone deacetylases improve the predictive value of IL-28B for chronic hepatitis C therapy.
23364788 2013 Nuclear calcium signaling regulates nuclear export of a subset of class IIa histone deacetylases following synaptic activity.
23297420 2013 Dephosphorylation at a conserved SP motif governs cAMP sensitivity and nuclear localization of class IIa histone deacetylases.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22991226 2012 Histone deacetylase 5 regulates glucose uptake and insulin action in muscle cells.
22941650 2012 MutS? and histone deacetylase complexes promote expansions of trinucleotide repeats in human cells.
22914591 2013 Loss of HDAC5 impairs memory function: implications for Alzheimer's disease.
22301920 2012 HDAC5 is required for maintenance of pericentric heterochromatin, and controls cell-cycle progression and survival of human cancer cells.
22243750 2012 Histone deacetylase 5 limits cocaine reward through cAMP-induced nuclear import.
21508384 2011 Abnormal methylation of histone deacetylase genes: implications on etiology and epigenetic therapy of astrocytomas.
21269460 2011 Initial characterization of the human central proteome.
21146494 2011 Evidence for the phosphorylation of serine259 of histone deacetylase 5 by protein kinase C?.
21081666 2011 Nuclear import of histone deacetylase 5 by requisite nuclear localization signal phosphorylation.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
21047791 2011 Class II histone deacetylases limit GLUT4 gene expression during adipocyte differentiation.
20716686 2010 PKA phosphorylates histone deacetylase 5 and prevents its nuclear export, leading to the inhibition of gene transcription and cardiomyocyte hypertrophy.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20408817 2010 SUMO modification regulates the transcriptional activity of XBP1.
20188095 2010 Protein kinase C-related kinase targets nuclear localization signals in a subset of class IIa histone deacetylases.
20042720 2010 Fluid shear stress stimulates phosphorylation-dependent nuclear export of HDAC5 and mediates expression of KLF2 and eNOS.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19801982 2009 Twenty bone-mineral-density loci identified by large-scale meta-analysis of genome-wide association studies.
19666599 2009 Human BAHD1 promotes heterochromatic gene silencing.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19351956 2009 HDAC5 is a repressor of angiogenesis and determines the angiogenic gene expression pattern of endothelial cells.
19071119 2009 Transcriptional activation of hypoxia-inducible factor-1alpha by HDAC4 and HDAC5 involves differential recruitment of p300 and FIH-1.
18332134 2008 Protein kinase D-dependent phosphorylation and nuclear export of histone deacetylase 5 mediates vascular endothelial growth factor-induced gene expression and angiogenesis.
18288090 2008 Pharmacogenetic analysis of genes implicated in rodent models of antidepressant response: association of TREK1 and treatment resistance in the STAR(*)D study.
18218981 2008 Ca2+/calmodulin-dependent protein kinase IIdelta and protein kinase D overexpression reinforce the histone deacetylase 5 redistribution in heart failure.
18184930 2008 AMP-activated protein kinase regulates GLUT4 transcription by phosphorylating histone deacetylase 5.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17975112 2008 Nitric oxide modulates chromatin folding in human endothelial cells via protein phosphatase 2A activation and class II histone deacetylases nuclear shuttling.
17872950 2007 Critical and functional regulation of CHOP (C/EBP homologous protein) through the N-terminal portion.
17373667 2007 Breast cancer associated transcriptional repressor PLU-1/JARID1B interacts directly with histone deacetylases.
16919237 2006 Breast cancer metastasis suppressor 1 (BRMS1) is stabilized by the Hsp90 chaperone.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16236793 2006 Class II histone deacetylases confer signal responsiveness to the ankyrin-repeat proteins ANKRA2 and RFXANK.
16221676 2005 G betagamma binds histone deacetylase 5 (HDAC5) and inhibits its transcriptional co-repression activity.
15923258 2005 An expression screen reveals modulators of class II histone deacetylase phosphorylation.
15590418 Screening of histone deacetylases (HDAC) expression in human prostate cancer reveals distinct class I HDAC profiles between epithelial and stromal cells.
15491607 2004 Alternative splice variants encoding unstable protein domains exist in the human brain.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15194749 2004 Functional interaction between class II histone deacetylases and ICP0 of herpes simplex virus type 1.
15161933 2004 Comprehensive proteomic analysis of interphase and mitotic 14-3-3-binding proteins.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12711221 2003 Class II histone deacetylases: versatile regulators.
12626519 2003 Direct interaction of Ca2+/calmodulin inhibits histone deacetylase 5 repressor core binding to myocyte enhancer factor 2.
12504096 2003 Point mutations in BCL6 DNA-binding domain reveal distinct roles for the six zinc fingers.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12354939 2002 Histone deacetylase 6 binds polyubiquitin through its zinc finger (PAZ domain) and copurifies with deubiquitinating enzymes.
12242305 2002 Association of class II histone deacetylases with heterochromatin protein 1: potential role for histone methylation in control of muscle differentiation.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
11929873 2002 Class II histone deacetylases are directly recruited by BCL6 transcriptional repressor.
11509672 2001 Identification of a signal-responsive nuclear export sequence in class II histone deacetylases.
11114197 2000 Activation of the myocyte enhancer factor-2 transcription factor by calcium/calmodulin-dependent protein kinase-stimulated binding of 14-3-3 to histone deacetylase 5.
11081517 2000 Signal-dependent nuclear export of a histone deacetylase regulates muscle differentiation.
11018260 2000 Chromosomal organization and localization of the human histone deacetylase 5 gene (HDAC5).
10983972 2000 Regulation of skeletal myogenesis by association of the MEF2 transcription factor with class II histone deacetylases.
10898795 2000 BCoR, a novel corepressor involved in BCL-6 repression.
10869435 2000 Regulation of histone deacetylase 4 and 5 and transcriptional activity by 14-3-3-dependent cellular localization.
10737771 2000 Signal-dependent activation of the MEF2 transcription factor by dissociation from histone deacetylases.
10220385 1999 Three proteins define a class of human histone deacetylases related to yeast Hda1p.
9628581 1998 Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
9610721 1998 Characterization of human colon cancer antigens recognized by autologous antibodies.