Property Summary

NCBI Gene PubMed Count 164
PubMed Score 235.95
PubTator Score 202.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
psoriasis -1.100 1.5e-03
osteosarcoma -3.234 3.0e-06
glioblastoma -1.400 7.0e-04
atypical teratoid / rhabdoid tumor -1.900 5.8e-06
group 3 medulloblastoma -1.400 4.3e-03
medulloblastoma, large-cell -2.200 2.2e-04
fascioscapulohumeral muscular dystrophy 1.109 1.4e-03
Amyotrophic Lateral Sclerosis 1.551 3.9e-06
acute quadriplegic myopathy 1.814 4.0e-07
tuberculosis 1.300 3.0e-05
lung cancer 2.100 5.9e-04
adult high grade glioma -1.600 3.6e-05
posterior fossa group A ependymoma -1.100 3.2e-07
subependymal giant cell astrocytoma -1.701 2.1e-02
gastric carcinoma 1.200 2.1e-02
invasive ductal carcinoma -1.700 6.7e-04
ovarian cancer -1.700 3.4e-07

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
651928 confirmatory 0 / 0 / 1 ML327 E-Cadherin HDAC Spectrum Assay_HDAC4

Gene RIF (97)

PMID Text
27106144 Mechanical compression regulates chondrocyte gene expression through HDAC4 relocation from the cell's cytoplasm to the nucleus via PP2A-dependent HDAC4 dephosphorylation.
26619800 Over-expression of HDAC4 suppressed the transcription of genes involved in energy expenditure in a SIRT1-dependent manner. In contrast, HDAC4 knockdown/inhibition neutralized the effect of IFN-gamma on cellular metabolism by normalizing SIRT1 expression
26572940 we demonstrate that nuclear HDAC4 is a key regulator promoting the progressive epithelial ovarian cancer on fibrillar collagen matrices
26568966 downregulated in sustained virologic responders compared to the spontaneous clearers of Hepatitis C
26540094 HDAC4 destabilizes MAP1S, suppresses autophagy flux and promotes the accumulation of mHTT aggregates.
26502922 Elevated HDAC-4 expression in Pancreatic Adenocarcinoma was significantly associated with the absence of organ metastases and borderline with the absence of lymph node metastases and tumor proliferative capacity.
26455434 HDAC4-RelB-p52 complex maintains repressive chromatin around proapoptotic genes Bim and BMF and regulates multiple myeloma survival and growth
26437241 the pro-inflammatory role of miR-22 in emphysema has revealed that HDAC4 specifically regulated smoking-related lung inflammation and TH17 responses
26414199 HDAC4 increases endogenous SIRT1 expression by enhancing its sumoylation modification levels
26305553 Among the class II HDACs, HDAC4 interacted with both MR and HDAC3 after aldosterone stimulation. The nuclear translocation of HDAC4 was mediated by protein kinase A (PKA) and protein phosphatases (PP)
26206152 Results show that overexpression of miR10b in ER-positive breast cancer cell lines led to increased resistance to tamoxifen and HDAC4 was identified as its direct target. MiR10b-HDAC4 nexus may be one of the molecular mechanism of tamoxifen resistance.
26161557 Molecular basis for the specific interactions between HDAC4 and the SMRT corepressor.
25612003 Idiopathic pulmonary fibrosis fibroblast interaction with polymerized type I collagen results in an aberrant PP2A/HDAC4 axis, which suppresses miR-29, causing a pathologic increase in type I collagen expression.
25515592 Increased expression of HDAC4 was found in cartilage from knee osteoarthritis patients.
25504437 This study leads to the discovery of a novel molecular mechanism in which the miRNA miR-125a-5p suppresses HDAC4 expression
25424126 Decreased HDAC4 partially contributes to the pathogenesis of osteoarthritis cartilage degeneration.
25329715 observations suggested that some other candidate genes for neuronal development exist in the telomeric region of HDAC4
25103231 expression of the proliferation marker Ki-67 exhibited a similar tendency with that of HDAC4
25091122 Data suggeet the potential clinical use of histone deacetylase 4 (HDAC4) inhibitors in combination with docetaxel for the treatment of gastric cancer.
25042803 Results show that HDAC4 is the Upstream 6PGD Deacetylase that removes acetylation from both K76 and K294 sites.
24896240 We demonstrated that HDAC4 promotes gastric cancer cell progression mediated through the repression of p21.
24861260 Dysregulation of HDAC4 and/or HDAC6 could play a role in the pathogenesis of Frontotemporal lobar degeneration-tau associated with Pick bodies
24830600 novel HDAC1/4/miR-200b/E2F3 signaling contributes to chemoresistance of human lung adenocarcinoma cells
24717296 Thus, HDAC4 contributes to podocyte injury and is one of critical components of a signal transduction pathway that links renal injury to autophagy in diabetic nephropathy.
24715439 Haploinsufficiency of HDAC4 does not cause intellectual disability in all affected individuals.
24579951 Data show that HDAC4 plays global roles in the regulation of gene transcription, cell growth, survival and proliferation, and their aberrant expression or activity leads to cancer development.
24308964 HDAC4 played an important role in the regulation of Endoplasmic reticulum stress-induced apoptosis through interacting with ATF4 and inhibiting its transcriptional activity.
24216484 analysis of eight members across four generations identified a missense mutation in the histone deacetylase 4 (HDAC4) gene that segregated with eating disorders
24086512 The expression pattern of HDAC4 in obese subjects before and after physical exercise, its correlation with various physical, clinical and metabolic parameters and its inhibitory effect on NF-kappaB are suggestive of a protective role against obesity.
24079712 EZH2 and HDAC4 represent mutually exclusive epigenetic pathways across human cancers
24043307 Correlation studies depicted two distinct groups of soft tissue sarcomas: one in which MEF2 repression correlates with PTEN downregulation and a second group in which MEF2 repression correlates with HDAC4 levels.
23948281 The expression of histone deacetylase 4 is associated with prednisone poor-response in childhood acute lymphoblastic leukemia.
23824486 muscle expression of histone deacetylase 4 may be a key factor for muscle reinnervation and disease progression in patients with amyotrophic lateral sclerosis.
23817620 Increased HDAC4 expression is associated with chemoresistance in breast cancer.
23456936 HHIP, HDAC4, NCR3 and RARB polymorphisms may have a role in impaired lung function that begins in early life
23434587 HDAC4 plays a central role for rapid modifications of histone methylation in response to variations in cardiac load.
23364788 Nuclear calcium signaling is a regulator of nuclear export of HDAC4 and HDAC5.
23349832 Data show that miR-22 specifically interacts with the 3' UTRs of the Rcor1, Rgs2 and HDAC4 mRNAs.
23297420 Dephosphorylation at a conserved SP motif governs cAMP sensitivity and nuclear localization of class IIa histone deacetylases HDAC4, 5 and 9
23188045 We conclude that HDAC4 haploinsufficiency is responsible for psychomotor and behavioural abnormalities in combination with the BDMR syndrome-specific facial dysmorphism pattern and that these clinical features have a central diagnostic relevance.
23149916 Studies indicate that the histone deacetylase HDAC4 as a target for the antiangiogenic activity of tasquinimod.
22826225 Amino acid starvation induces reactivation of silenced transgenes and latent HIV-1 provirus via down-regulation of histone deacetylase 4
22826225 Amino acid starvation-dependent HDAC4 downregulation leads to HIV-1 transcriptional activation and RT activity production in T-lymphocytes
22700976 Metastasis-associated protein 1/histone deacetylase 4-nucleosome remodeling and deacetylase complex regulates phosphatase and tensin homolog gene expression and function.
21917920 HDAC4 protein regulates HIF1alpha protein lysine acetylation and cancer cell response to hypoxia
21837748 HDAC4/Sp1/miR-200a regulatory network induces the down-regulation of miR-200a and the up-regulation of HDAC4 in hepatocellular carcinoma.
21542139 Deletion of hda4, a homolog of HDAC4, enhances learning and long-term memory in a thermotaxis model using Caenorhabditis elegans.
21464227 The novel mechanism of action for HDAC4, suggesting it can function to dynamically regulate gene expression through changes in chromatin-nucleoporin association.
21118993 HDAC4 regulates random cell motility
20846395 The authors observed that HDAC4 associates with HIV-1 viral DNA in a viral integrase-dependent manner.
20691407 Haploinsufficiency of HDAC4 results in brachydactyly mental retardation syndrome.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20471694 The results suggest that HDAC4 genes might play a role in the pathophysiology of schizophrenia in a Korean population.
20471694 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20383178 found that the histone acetylation level and the binding of the transcriptional factor Sp1 to the interleukin-24 promoter were reduced upon HDAC4 treatment.
20116378 JNK-ATF-2 inhibits thrombomodulin (TM) expression by recruiting histone deacetylase4 (HDAC4) and forming a transcriptional repression complex in the TM promoter.
20097749 HDAC4 represses matrix metalloproteinase-13 transcription in osteoblastic cells, and parathyroid hormone controls this repression
19956841 apicidin acts as an effective anti-tumor agent on human endometrial cancer cells by regulating cell proliferation and apoptosis through the down-regulation of HDAC3 and HDAC4
19913121 Observational study of gene-disease association. (HuGE Navigator)
19716643 show that HDAC4 overexpression promotes TGF-beta1-induced synovium-derived stem cells chondrogenesis but inhibits chondrogenically differentiated stem cell hypertrophy.
19700647 These data demonstrate that the differentiation of normal human lung fibroblasts to myofibroblasts is HDAC4 dependent and requires phosphorylation of Akt.
19679847 Observational study of gene-disease association. (HuGE Navigator)
19509297 reduced expression of HDAC4 in chondrosarcoma cells increases expression of Runx2 leading to increased expression of VEGF and in vitro angiogenesis
19355988 recent developments in the crystal structure analysis of human HDAC4, HDAC7, and HDAC8 [REVIEW]
19115247 HDAC4 contributes to transcriptional induction of mPGES-1 by IL-1 through a mechanism involving up-regulation of Egr-1 transcriptional activity
19071119 These results indicate that HDAC4 and HDAC5 increase the transactivation function of HIF-1alpha by promoting dissociation of HIF-1alpha from FIH-1 and association with p300.
19015268 P/CAF deacetylation by HDAC3 and in a minor degree by HDAC1, HDAC2, or HDAC4 leads to cytoplasmic accumulation of P/CAF.
18952052 Analysis of a series of HDAC4 mutants by nuclear import assay suggested that phosphorylation and subsequent 14-3-3 binding reduce nuclear import rather than enhancing nuclear export.
18850004 HDAC4 interacts with Sp1, binds and reduces histone H3 acetylation at the Sp1/Sp3 binding site-rich p21(WAF1/Cip1) proximal promoter, suggesting a key role for Sp1 in HDAC4-mediated repression of p21(WAF1/Cip1).
18780762 This study showed that in skeletal muscle, HDAC4 is a critical modulator of MEF2-dependent structural and contractile gene expression in response to neural activity.
18632985 HDAC4 is a novel regulator of colon cell proliferation through repression of p21
18614528 Structural and functional analysis of the human HDAC4 catalytic domain reveals a regulatory structural zinc-binding domain
18227124 These findings revealed that TNF-alpha induced VCAM-1 expression via multiple signaling pathways.
18045992 These observations suggest that PP2A, via the dephosphorylation of multiple serines including the 14-3-3 binding sites and serine 298, controls HDAC4 nuclear import.
17975112 NO-dependent PP2A activation plays a key role in nuclear translocation of class II HDACs HDAC4 and HDAC5
17885209 Results show that recruitment of histone deacetylase 4 is involves the CRIF1-mediated inhibition of AR transactivation.
17636017 Data suggest that, through specific posttranslation modifications, extracellular signals control two distinct nuclear pools of HDAC4 to differentially dictate cell death and differentiation.
17610967 HDAC4 is an essential epigenetic regulator of MF differentiation and HDAC4 is a potential target for treating MF-related disorders.
17383980 expression of the silencing mediator of retinoid and thyroid receptor (SMRT) & histone deacetylase4 (HDAC4) enhances formation of Bach2 foci in nuclear matrix. SMRT mediates HDAC4 binding to Bach2, & HDAC4 facilitates retention of Bach2 in the foci.
17373667 Results show that both JARID1B and HDAC4 expressed in breast cancers.
17360518 crystallographic analysis of the N-terminal domain of histone deacetylase 4
17179159 HDAC4 as a specific downstream substrate of CaMKIIdeltaB in cardiac cells and have broad applications for the signaling pathways leading to cardiac hypertrophy and heart failure.
16922677 HDAC4 (histone deacetylase 4) and p300, a known HAT (histone acetyltransferase), reversibly controlled the activity of the IL-5 promoter in vivo and in vitro, with a concurrent alteration of histone H3 acetylation status at the promoter regions.
16767219 Results show that calcium/calmodulin-dependent kinase II (CaMKII) signals specifically to histone deacetylase (HDAC)4 by binding to a unique docking site that is absent in other class IIa HDACs.
16415175 Observational study of gene-disease association. (HuGE Navigator)
16166628 histone deacetylase 4- and SIRT1 deacetylase-mediated lysine modifications regulate MEF2
16051668 HDAC4 regulates ERalpha activity as a N-terminal coregulator.
15467736 data indicate that recruitment of HDAC4 is necessary for PLZF-mediated repression in both normal and leukaemic cells
15205465 HDAC4 has a role in cell death and differentiation
15194749 ICP0 of herpes simplex virus type 1 interacts with and controls the repressor activity of class II HDAC4
15075374 caspases could specifically modulate gene repression and apoptosis through the proteolyic processing of HDAC4
12943985 the zinc fingers of nuclear receptors provide a general interaction interface for HDACs 3 and 4, recruiting HDACs 3 and 4 to the target DNA causing demonstrable histone deacetylation
12709441 full-length HDAC4 can repress MEF2 through multiple independent repressive domains
12668657 This protein interacts with 53BP1 to mediate DNA damage response.
12242305 MITR, HDAC4, and HDAC5 associate with heterochromatin protein 1 (HP1), an adaptor protein that recognizes methylated lysines within histone tails and mediates transcriptional repression by recruiting histone methyltransferase
12032081 The SUMO E3 ligase RanBP2 promotes modification of the HDAC4 deacetylase
11792813 HDAC4 is primarily a cytoplasmic resident protein, requiring a trans-acting nuclear localization signal for nuclear localization.

AA Sequence

MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVATALPLQVAPSAVPMDLRLDHQFSLPVAEPALREQQ      1 - 70
LQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLAMKHQQELLEHQRKLERHRQE     71 - 140
QELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVLNKKKALAHRNLNHCISSDPRYWYGKTQHSS    141 - 210
LDQSSPPQSGVSTSYNHPVLGMYDAKDDFPLRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTAL    211 - 280
KKRPLDVTDSACSSAPGSGPSSPNNSSGSVSAENGIAPAVPSIPAETSLAHRLVAREGSAAPLPLYTSPS    281 - 350
LPNITLGLPATGPSAGTAGQQDAERLTLPALQQRLSLFPGTHLTPYLSTSPLERDGGAAHSPLLQHMVLL    351 - 420
EQPPAQAPLVTGLGALPLHAQSLVGADRVSPSIHKLRQHRPLGRTQSAPLPQNAQALQHLVIQQQHQQFL    421 - 490
EKHKQQFQQQQLQMNKIIPKPSEPARQPESHPEETEEELREHQALLDEPYLDRLPGQKEAHAQAGVQVKQ    491 - 560
EPIESDEEEAEPPREVEPGQRQPSEQELLFRQQALLLEQQRIHQLRNYQASMEAAGIPVSFGGHRPLSRA    561 - 630
QSSPASATFPVSVQEPPTKPRFTTGLVYDTLMLKHQCTCGSSSSHPEHAGRIQSIWSRLQETGLRGKCEC    631 - 700
IRGRKATLEELQTVHSEAHTLLYGTNPLNRQKLDSKKLLGSLASVFVRLPCGGVGVDSDTIWNEVHSAGA    701 - 770
ARLAVGCVVELVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAVAAKLLQQRLSVSKILIVDWD    771 - 840
VHHGNGTQQAFYSDPSVLYMSLHRYDDGNFFPGSGAPDEVGTGPGVGFNVNMAFTGGLDPPMGDAEYLAA    841 - 910
FRTVVMPIASEFAPDVVLVSSGFDAVEGHPTPLGGYNLSARCFGYLTKQLMGLAGGRIVLALEGGHDLTA    911 - 980
ICDASEACVSALLGNELDPLPEKVLQQRPNANAVRSMEKVMEIHSKYWRCLQRTTSTAGRSLIEAQTCEN    981 - 1050
EEAETVTAMASLSVGVKPAEKRPDEEPMEEEPPL                                       1051 - 1084
//

Text Mined References (175)

PMID Year Title
27106144 2016 Compression regulates gene expression of chondrocytes through HDAC4 nuclear relocation via PP2A-dependent HDAC4 dephosphorylation.
26619800 2016 HDAC4 mediates IFN-? induced disruption of energy expenditure-related gene expression by repressing SIRT1 transcription in skeletal muscle cells.
26572940 2016 Histone deacetylase 4 increases progressive epithelial ovarian cancer cells via repression of p21 on fibrillar collagen matrices.
26568966 2015 Peripheral Blood Mononuclear Cell Gene Expression Remains Broadly Altered Years after Successful Interferon-Based Hepatitis C Virus Treatment.
26540094 2015 Blocking the association of HDAC4 with MAP1S accelerates autophagy clearance of mutant Huntingtin.
26502922 2015 Histone deacetylase (HDAC)-1, -2, -4 and -6 expression in human pancreatic adenocarcinoma: associations with clinicopathological parameters, tumor proliferative capacity and patients' survival.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26455434 2015 Transcriptional repression by the HDAC4-RelB-p52 complex regulates multiple myeloma survival and growth.
26437241 2015 The microRNA miR-22 inhibits the histone deacetylase HDAC4 to promote T(H)17 cell-dependent emphysema.
26414199 2016 HDAC4 stabilizes SIRT1 via sumoylation SIRT1 to delay cellular senescence.
26305553 2015 Histone Deacetylase 3 and 4 Complex Stimulates the Transcriptional Activity of the Mineralocorticoid Receptor.
26206152 2015 Functional role of miR-10b in tamoxifen resistance of ER-positive breast cancer cells through down-regulation of HDAC4.
26161557 2015 Mutagenesis Study Reveals the Rim of Catalytic Entry Site of HDAC4 and -5 as the Major Binding Surface of SMRT Corepressor.
25612003 2015 Pathologic Regulation of Collagen I by an Aberrant Protein Phosphatase 2A/Histone Deacetylase C4/MicroRNA-29 Signal Axis in Idiopathic Pulmonary Fibrosis Fibroblasts.
25515592 2014 Histone deacetylase 4 alters cartilage homeostasis in human osteoarthritis.
25504437 2015 miR-125a-5p is a prognostic biomarker that targets HDAC4 to suppress breast tumorigenesis.
25424126 2014 Decreased histone deacetylase 4 is associated with human osteoarthritis cartilage degeneration by releasing histone deacetylase 4 inhibition of runt-related transcription factor-2 and increasing osteoarthritis-related genes: a novel mechanism of human osteoarthritis cartilage degeneration.
25416956 2014 A proteome-scale map of the human interactome network.
25329715 2014 Neuropsychological profiles of patients with 2q37.3 deletion associated with developmental dyspraxia.
25103231 2014 Up-regulation of HDAC4 is associated with Schwann cell proliferation after sciatic nerve crush.
25091122 2014 Inhibition of histone deacetylase 4 increases cytotoxicity of docetaxel in gastric cancer cells.
25042803 2014 Lysine acetylation activates 6-phosphogluconate dehydrogenase to promote tumor growth.
24896240 2014 Histone deacetylase HDAC4 promotes gastric cancer SGC-7901 cells progression via p21 repression.
24861260 2015 Histone deacetylases (HDACs) in frontotemporal lobar degeneration.
24830600 2014 HDAC 1/4-mediated silencing of microRNA-200b promotes chemoresistance in human lung adenocarcinoma cells.
24717296 2014 Histone deacetylase 4 selectively contributes to podocyte injury in diabetic nephropathy.
24715439 2014 Haploinsufficiency of HDAC4 does not cause intellectual disability in all affected individuals.
24579951 2014 HDAC4: mechanism of regulation and biological functions.
24413532 2014 Differential regulation of estrogen receptor ? expression in breast cancer cells by metastasis-associated protein 1.
24308964 2014 HDAC4 protects cells from ER stress induced apoptosis through interaction with ATF4.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
24229708 2013 Runx3 inactivation is a crucial early event in the development of lung adenocarcinoma.
24216484 2013 Eating disorder predisposition is associated with ESRRA and HDAC4 mutations.
24169519 2014 20 ans après: a second mutation in MAOA identified by targeted high-throughput sequencing in a family with altered behavior and cognition.
24086512 2013 Proteomics analysis of human obesity reveals the epigenetic factor HDAC4 as a potential target for obesity.
24079712 2013 Genomic pathway analysis reveals that EZH2 and HDAC4 represent mutually exclusive epigenetic pathways across human cancers.
24043307 2013 MEF2 is a converging hub for histone deacetylase 4 and phosphatidylinositol 3-kinase/Akt-induced transformation.
23948281 2013 The expression of histone deacetylase 4 is associated with prednisone poor-response in childhood acute lymphoblastic leukemia.
23867755 2013 Involvement of Epac1/Rap1/CaMKI/HDAC5 signaling cascade in the regulation of placental cell fusion.
23824486 2013 Muscle histone deacetylase 4 upregulation in amyotrophic lateral sclerosis: potential role in reinnervation ability and disease progression.
23817620 2013 Histone deacetylase 4 mediates SMAD family member 4 deacetylation and induces 5-fluorouracil resistance in breast cancer cells.
23752268 2013 The functional interactome landscape of the human histone deacetylase family.
23456936 2013 HHIP, HDAC4, NCR3 and RARB polymorphisms affect fetal, childhood and adult lung function.
23453885 2013 Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis.
23434587 2013 HDAC4 controls histone methylation in response to elevated cardiac load.
23364788 2013 Nuclear calcium signaling regulates nuclear export of a subset of class IIa histone deacetylases following synaptic activity.
23349832 2013 MicroRNA-22 (miR-22) overexpression is neuroprotective via general anti-apoptotic effects and may also target specific Huntington's disease-related mechanisms.
23297420 2013 Dephosphorylation at a conserved SP motif governs cAMP sensitivity and nuclear localization of class IIa histone deacetylases.
23284291 2012 Genome-wide joint meta-analysis of SNP and SNP-by-smoking interaction identifies novel loci for pulmonary function.
23188045 2013 Phenotypic variant of Brachydactyly-mental retardation syndrome in a family with an inherited interstitial 2q37.3 microdeletion including HDAC4.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23149916 2013 Tasquinimod Is an Allosteric Modulator of HDAC4 survival signaling within the compromised cancer microenvironment.
22826225 2012 Amino acid starvation induces reactivation of silenced transgenes and latent HIV-1 provirus via down-regulation of histone deacetylase 4 (HDAC4).
22700976 2012 Metastasis-associated protein 1/histone deacetylase 4-nucleosome remodeling and deacetylase complex regulates phosphatase and tensin homolog gene expression and function.
22693459 2012 Six novel susceptibility Loci for early-onset androgenetic alopecia and their unexpected association with common diseases.
22649097 2012 Sequence-specific recognition of a PxLPxI/L motif by an ankyrin repeat tumbler lock.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21946350 2011 Genome-wide association and large-scale follow up identifies 16 new loci influencing lung function.
21917920 2011 HDAC4 protein regulates HIF1? protein lysine acetylation and cancer cell response to hypoxia.
21837748 2011 The histone deacetylase 4/SP1/microrna-200a regulatory network contributes to aberrant histone acetylation in hepatocellular carcinoma.
21542139 2011 Intracellular trafficking of histone deacetylase 4 regulates long-term memory formation.
21464227 2011 Modulation of chromatin position and gene expression by HDAC4 interaction with nucleoporins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21242980 2011 Inhibition of androgen receptor activity by histone deacetylase 4 through receptor SUMOylation.
21118993 2011 Ubiquitin-dependent degradation of HDAC4, a new regulator of random cell motility.
20936779 2010 A human MAP kinase interactome.
20846395 2010 A role for the histone deacetylase HDAC4 in the life-cycle of HIV-1-based vectors.
20691407 2010 Haploinsufficiency of HDAC4 causes brachydactyly mental retardation syndrome, with brachydactyly type E, developmental delays, and behavioral problems.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20471694 2010 Association of histone deacetylase genes with schizophrenia in Korean population.
20383178 2010 HDAC4 inhibits the transcriptional activation of mda-7/IL-24 induced by Sp1.
20116378 2010 JNK-ATF-2 inhibits thrombomodulin (TM) expression by recruiting histone deacetylase4 (HDAC4) and forming a transcriptional repression complex in the TM promoter.
20110259 2010 Involvement of histone deacetylation in MORC2-mediated down-regulation of carbonic anhydrase IX.
20097749 2010 HDAC4 represses matrix metalloproteinase-13 transcription in osteoblastic cells, and parathyroid hormone controls this repression.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19956841 2010 Anti-tumor effect of apicidin on Ishikawa human endometrial cancer cells both in vitro and in vivo by blocking histone deacetylase 3 and 4.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19716643 2009 Histone deacetylase 4 promotes TGF-beta1-induced synovium-derived stem cell chondrogenesis but inhibits chondrogenically differentiated stem cell hypertrophy.
19700647 2009 Abrogation of TGF-beta1-induced fibroblast-myofibroblast differentiation by histone deacetylase inhibition.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19679847 2009 Multi-ethnic genetic association study of carotid intima-media thickness using a targeted cardiovascular SNP microarray.
19509297 2009 HDAC4 represses vascular endothelial growth factor expression in chondrosarcoma by modulating RUNX2 activity.
19355988 2009 Novel structural insights into class I and II histone deacetylases.
19281832 2009 Activation of ROS/NF-kappaB and Ca2+/CaM kinase II are necessary for VCAM-1 induction in IL-1beta-treated human tracheal smooth muscle cells.
19276356 2009 FOXP3 up-regulates p21 expression by site-specific inhibition of histone deacetylase 2/histone deacetylase 4 association to the locus.
19115247 2009 HDAC4 contributes to IL-1-induced mPGES-1 expression in human synovial fibroblasts through up-regulation of Egr-1 transcriptional activity.
19071119 2009 Transcriptional activation of hypoxia-inducible factor-1alpha by HDAC4 and HDAC5 involves differential recruitment of p300 and FIH-1.
19015268 2009 Autoacetylation regulates P/CAF nuclear localization.
18952052 2008 14-3-3 regulates the nuclear import of class IIa histone deacetylases.
18850004 2009 HDAC4 represses p21(WAF1/Cip1) expression in human cancer cells through a Sp1-dependent, p53-independent mechanism.
18780762 2009 The deacetylase HDAC4 controls myocyte enhancing factor-2-dependent structural gene expression in response to neural activity.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18632985 2008 HDAC4 promotes growth of colon cancer cells via repression of p21.
18614528 2008 Structural and functional analysis of the human HDAC4 catalytic domain reveals a regulatory structural zinc-binding domain.
18227124 2008 Tumor necrosis factor-alpha enhances neutrophil adhesiveness: induction of vascular cell adhesion molecule-1 via activation of Akt and CaM kinase II and modifications of histone acetyltransferase and histone deacetylase 4 in human tracheal smooth muscle cells.
18045992 2008 PP2A regulates HDAC4 nuclear import.
17979178 2007 A novel tandem affinity purification strategy for the efficient isolation and characterisation of native protein complexes.
17975112 2008 Nitric oxide modulates chromatin folding in human endothelial cells via protein phosphatase 2A activation and class II histone deacetylases nuclear shuttling.
17885209 2008 CR6-interacting factor 1 represses the transactivation of androgen receptor by direct interaction.
17696781 2007 Sumoylation of the zinc finger protein ZXDC enhances the function of its transcriptional activation domain.
17636017 2007 Dephosphorylation and caspase processing generate distinct nuclear pools of histone deacetylase 4.
17610967 2007 Histone deacetylase 4 is required for TGFbeta1-induced myofibroblastic differentiation.
17383980 2007 Co-repressor SMRT and class II histone deacetylases promote Bach2 nuclear retention and formation of nuclear foci that are responsible for local transcriptional repression.
17373667 2007 Breast cancer associated transcriptional repressor PLU-1/JARID1B interacts directly with histone deacetylases.
17360518 2007 Crystal structure of a conserved N-terminal domain of histone deacetylase 4 reveals functional insights into glutamine-rich domains.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17179159 2007 Nuclear calcium/calmodulin-dependent protein kinase IIdelta preferentially transmits signals to histone deacetylase 4 in cardiac cells.
17011572 2006 Class II HDACs mediate CaMK-dependent signaling to NRSF in ventricular myocytes.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16922677 2006 Recruitment of histone deacetylase 4 by transcription factors represses interleukin-5 transcription.
16919237 2006 Breast cancer metastasis suppressor 1 (BRMS1) is stabilized by the Hsp90 chaperone.
16767219 2006 CaM kinase II selectively signals to histone deacetylase 4 during cardiomyocyte hypertrophy.
16528103 2006 Histone deacetylase 3 binds to and regulates the GCMa transcription factor.
16415175 2006 High throughput SNP and expression analyses of candidate genes for non-syndromic oral clefts.
16236793 2006 Class II histone deacetylases confer signal responsiveness to the ankyrin-repeat proteins ANKRA2 and RFXANK.
16166628 2005 Regulation of MEF2 by histone deacetylase 4- and SIRT1 deacetylase-mediated lysine modifications.
16147992 2005 Analysis of BCL6-interacting proteins by tandem mass spectrometry.
16051668 2005 Recruitment of histone deacetylase 4 to the N-terminal region of estrogen receptor alpha.
16033423 2005 The POZ/BTB protein NAC1 interacts with two different histone deacetylases in neuronal-like cultures.
15964851 2005 Identification of the ankyrin repeat proteins ANKRA and RFXANK as novel partners of class IIa histone deacetylases.
15829968 2005 Transcriptional regulation of a metastasis suppressor gene by Tip60 and beta-catenin complexes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15778465 2005 Targeted proteomic analysis of 14-3-3 sigma, a p53 effector commonly silenced in cancer.
15743821 2005 PC4 coactivates MyoD by relieving the histone deacetylase 4-mediated inhibition of myocyte enhancer factor 2C.
15537544 2004 Histone deacetylase 4 controls chondrocyte hypertrophy during skeletogenesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15467736 2004 HDAC4 mediates transcriptional repression by the acute promyelocytic leukaemia-associated protein PLZF.
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15205465 2004 Caspase-mediated specific cleavage of human histone deacetylase 4.
15194749 2004 Functional interaction between class II histone deacetylases and ICP0 of herpes simplex virus type 1.
15184363 2004 Identification of a novel family of ankyrin repeats containing cofactors for p160 nuclear receptor coactivators.
15161933 2004 Comprehensive proteomic analysis of interphase and mitotic 14-3-3-binding proteins.
15138260 2004 Transforming growth factor-beta stimulates p300-dependent RUNX3 acetylation, which inhibits ubiquitination-mediated degradation.
15075374 2004 Caspase-dependent regulation of histone deacetylase 4 nuclear-cytoplasmic shuttling promotes apoptosis.
12943985 2003 Interaction of nuclear receptor zinc finger DNA binding domains with histone deacetylase.
12711221 2003 Class II histone deacetylases: versatile regulators.
12709441 2003 Functional characterization of an amino-terminal region of HDAC4 that possesses MEF2 binding and transcriptional repressive activity.
12668657 2003 Histone deacetylase 4 interacts with 53BP1 to mediate the DNA damage response.
12590135 2003 The histone deacetylase 9 gene encodes multiple protein isoforms.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421765 2002 Protein-protein interactions between large proteins: two-hybrid screening using a functionally classified library composed of long cDNAs.
12242305 2002 Association of class II histone deacetylases with heterochromatin protein 1: potential role for histone methylation in control of muscle differentiation.
12032081 2002 The SUMO E3 ligase RanBP2 promotes modification of the HDAC4 deacetylase.
11929873 2002 Class II histone deacetylases are directly recruited by BCL6 transcriptional repressor.
11804585 2002 Enzymatic activity associated with class II HDACs is dependent on a multiprotein complex containing HDAC3 and SMRT/N-CoR.
11792813 2001 The nuclear localization domain of the MEF2 family of transcription factors shows member-specific features and mediates the nuclear import of histone deacetylase 4.
11568182 2001 Interaction of EVI1 with cAMP-responsive element-binding protein-binding protein (CBP) and p300/CBP-associated factor (P/CAF) results in reversible acetylation of EVI1 and in co-localization in nuclear speckles.
11509672 2001 Identification of a signal-responsive nuclear export sequence in class II histone deacetylases.
11504882 2001 Differential localization of HDAC4 orchestrates muscle differentiation.
11486037 2001 Histone deacetylase 4 possesses intrinsic nuclear import and export signals.
11474199 2001 Assignment of the human histone deacetylase 4 gene (HDAC4) to chromosome 2q37.2 by in situ hybridization.
11470791 2001 The modular nature of histone deacetylase HDAC4 confers phosphorylation-dependent intracellular trafficking.
11466315 2001 Human HDAC7 histone deacetylase activity is associated with HDAC3 in vivo.
11463856 2001 The orphan nuclear receptor TR2 interacts directly with both class I and class II histone deacetylases.
11451954 2001 Polymeric chains of SUMO-2 and SUMO-3 are conjugated to protein substrates by SAE1/SAE2 and Ubc9.
11114197 2000 Activation of the myocyte enhancer factor-2 transcription factor by calcium/calmodulin-dependent protein kinase-stimulated binding of 14-3-3 to histone deacetylase 5.
11114188 2000 Histone deacetylase 4 associates with extracellular signal-regulated kinases 1 and 2, and its cellular localization is regulated by oncogenic Ras.
11081517 2000 Signal-dependent nuclear export of a histone deacetylase regulates muscle differentiation.
10983972 2000 Regulation of skeletal myogenesis by association of the MEF2 transcription factor with class II histone deacetylases.
10958686 2000 Regulation of histone deacetylase 4 by binding of 14-3-3 proteins.
10944117 2000 Both corepressor proteins SMRT and N-CoR exist in large protein complexes containing HDAC3.
10898795 2000 BCoR, a novel corepressor involved in BCL-6 repression.
10869435 2000 Regulation of histone deacetylase 4 and 5 and transcriptional activity by 14-3-3-dependent cellular localization.
10825153 2000 Calcium regulates transcriptional repression of myocyte enhancer factor 2 by histone deacetylase 4.
10523670 1999 HDAC4, a human histone deacetylase related to yeast HDA1, is a transcriptional corepressor.
10487761 1999 HDAC4 deacetylase associates with and represses the MEF2 transcription factor.
10220385 1999 Three proteins define a class of human histone deacetylases related to yeast Hda1p.
10206986 1999 A new family of human histone deacetylases related to Saccharomyces cerevisiae HDA1p.
9179496 1997 Construction and characterization of human brain cDNA libraries suitable for analysis of cDNA clones encoding relatively large proteins.
9150131 1997 What's up and down with histone deacetylation and transcription?
9139815 1997 Transcriptional control. Sinful repression.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
7847374 1995 Brachydactyly and mental retardation: an Albright hereditary osteodystrophy-like syndrome localized to 2q37.