Property Summary

Ligand Count 378
NCBI Gene PubMed Count 181
PubMed Score 255.54
PubTator Score 202.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Obesity 678 0.0 0.9
Disease Target Count Z-score Confidence
Pseudohypoparathyroidism 18 4.189 2.1
Cancer 2499 3.856 1.9

Expression

  Differential Expression (17)

Disease log2 FC p
acute quadriplegic myopathy 1.800 2.6e-06
adult high grade glioma -1.600 3.6e-05
Amyotrophic lateral sclerosis 1.551 3.9e-06
atypical teratoid / rhabdoid tumor -1.600 9.5e-04
fascioscapulohumeral muscular dystrophy 1.109 1.4e-03
gastric carcinoma 1.200 2.1e-02
glioblastoma -1.100 4.2e-05
group 3 medulloblastoma -1.400 4.3e-03
invasive ductal carcinoma -1.600 2.0e-03
lung cancer 2.100 5.9e-04
medulloblastoma, large-cell -2.100 1.3e-03
osteosarcoma -2.733 4.4e-05
ovarian cancer -1.700 3.4e-07
posterior fossa group A ependymoma -1.100 3.2e-07
psoriasis -1.100 1.5e-03
subependymal giant cell astrocytoma -1.463 2.7e-02
tuberculosis 1.300 3.0e-05

Protein-protein Interaction (2)

PDB (14)

Gene RIF (109)

AA Sequence

MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVATALPLQVAPSAVPMDLRLDHQFSLPVAEPALREQQ      1 - 70
LQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLAMKHQQELLEHQRKLERHRQE     71 - 140
QELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVLNKKKALAHRNLNHCISSDPRYWYGKTQHSS    141 - 210
LDQSSPPQSGVSTSYNHPVLGMYDAKDDFPLRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTAL    211 - 280
KKRPLDVTDSACSSAPGSGPSSPNNSSGSVSAENGIAPAVPSIPAETSLAHRLVAREGSAAPLPLYTSPS    281 - 350
LPNITLGLPATGPSAGTAGQQDAERLTLPALQQRLSLFPGTHLTPYLSTSPLERDGGAAHSPLLQHMVLL    351 - 420
EQPPAQAPLVTGLGALPLHAQSLVGADRVSPSIHKLRQHRPLGRTQSAPLPQNAQALQHLVIQQQHQQFL    421 - 490
EKHKQQFQQQQLQMNKIIPKPSEPARQPESHPEETEEELREHQALLDEPYLDRLPGQKEAHAQAGVQVKQ    491 - 560
EPIESDEEEAEPPREVEPGQRQPSEQELLFRQQALLLEQQRIHQLRNYQASMEAAGIPVSFGGHRPLSRA    561 - 630
QSSPASATFPVSVQEPPTKPRFTTGLVYDTLMLKHQCTCGSSSSHPEHAGRIQSIWSRLQETGLRGKCEC    631 - 700
IRGRKATLEELQTVHSEAHTLLYGTNPLNRQKLDSKKLLGSLASVFVRLPCGGVGVDSDTIWNEVHSAGA    701 - 770
ARLAVGCVVELVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAVAAKLLQQRLSVSKILIVDWD    771 - 840
VHHGNGTQQAFYSDPSVLYMSLHRYDDGNFFPGSGAPDEVGTGPGVGFNVNMAFTGGLDPPMGDAEYLAA    841 - 910
FRTVVMPIASEFAPDVVLVSSGFDAVEGHPTPLGGYNLSARCFGYLTKQLMGLAGGRIVLALEGGHDLTA    911 - 980
ICDASEACVSALLGNELDPLPEKVLQQRPNANAVRSMEKVMEIHSKYWRCLQRTTSTAGRSLIEAQTCEN    981 - 1050
EEAETVTAMASLSVGVKPAEKRPDEEPMEEEPPL                                       1051 - 1084
//

Text Mined References (192)

PMID Year Title