Property Summary

Ligand Count 598
NCBI Gene PubMed Count 237
PubMed Score 142.91
PubTator Score 276.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Heart Diseases 43 0.0 0.0
Disease Target Count
Schizophrenia 1160
Disease Target Count P-value
malignant mesothelioma 3232 1.5e-05
Disease Target Count Z-score Confidence
Cancer 2499 3.537 1.8
Neuronal ceroid lipofuscinosis 2 17 3.185 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma 1.100 1.5e-05

Protein-protein Interaction (3)

Gene RIF (151)

AA Sequence

MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFL      1 - 70
QRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFE     71 - 140
ASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVG    141 - 210
AESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECV    211 - 280
EYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQN    281 - 350
SRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDN    351 - 420
DKESDVEI                                                                  421 - 428
//

Text Mined References (245)

PMID Year Title