Property Summary

NCBI Gene PubMed Count 213
PubMed Score 132.19
PubTator Score 276.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma 1.100 1.5e-05

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
485318 confirmatory 1 / 4 / 1408 Histone deacetylase 3 counterscreen for GASC1 inhibitors Measured in Biochemical System Using Plate Reader - 2043-03_Inhibitor_Dose_CherryPick
651916 confirmatory 0 / 0 / 1 ML327 E-Cadherin HDAC Spectrum Assay_HDAC3

Gene RIF (131)

PMID Text
26704017 this is the first report on the regulation mechanism of SIRT7 gene, in which, HDAC3 collaborated with C/EBPalpha to occupy its responding element in the upstream region of SIRT7 gene and repressed its expression in human cells.
26663086 Data suggest that complexes of HDAC3-H1.3 with NCOR1 and NCOR2/SMRT accumulate on chromatin in synchronized HeLa cells in late G2 phase and mitosis; deacetylation activity of HDAC3 is activated via phosphorylation of Ser-424 by CK2 only in mitosis.
26542778 Sequencing of HDAC3 revealed six single-nucleotide polymorphisms. The G allele of rs2530223 was significantly associated with the number of acute medications/month used and with the number of days/month in which medications were used
26531724 HDAC3 knockdown or HDAC3 inhibition was associated with simultaneous upregulation of the expression of miR130a and downregulation of the expression of TNF1alpha in peripheral blood mononuclear cells.
26450925 These data suggest that HDAC3 indirectly modulates tubulin acetylation
26420860 Data suggest, in chronic hepatitis C virus infection, HDAC9 (histone deacetylase 9) induction in liver regulates hepatic gluconeogenesis and systemic insulin resistance via deacetylation of FoxO1 (Forkhead box O 1) and HDAC3 (histone deacetylase 3).
26359372 Aberrant overexpression of HDACs in basal cells of IPF lungs may contribute to the bronchiolisation process in this disease. Similarly, generation and apoptosis resistance of IPF fibroblasts are mediated by enhanced activity of HDAC enzymes.
26305553 Among the class II HDACs, HDAC4 interacted with both MR and HDAC3 after aldosterone stimulation. The nuclear translocation of HDAC4 was mediated by protein kinase A (PKA) and protein phosphatases (PP)
25997740 miR-335 exerted apoptotic effects and inhibited ubiquitination of HDAC3 in anti-cancer drug-resistant cancer cell lines. miR-335 negatively regulated the invasion, migration, and growth rate of cancer cells.
25973054 These observations suggested that HDAC3 plays an important role in the pathological courses of spinal cord injury by regulating miR-130a expression
25940092 HDAC3 contributes to vasculogenic mimicry in gliomas, possibly through the PI3K/ERK-MMPs-laminin5gamma2 signaling pathway.
25892518 PML-mediated suppression of IL-6-induced STAT3 activation by disrupting interactions between STAT3 and HDAC3.
25678599 The inhibition of the transcriptional activity of BCL9-2 by WWOX and HDAC3 constitutes a new molecular mechanism and provides new insight for a broad range of cancers.
25644061 SOX4 interacts with EZH2 and HDAC3 to suppress microRNA-31 in invasive esophageal cancer cells.
25623232 ZBP-89 attenuates HDAC3 by increasing IkappaB degradation, dependent on Pin1 but independent of NF-Kappab
25610877 Data point to HDAC3 as a potential drug target for preserving beta cells against lipotoxicity in diabetes.
25380050 Htt aggregates impair nuclear proteasome activity through the inhibition of HDAC3
25307283 Time-course analysis revealed that HDAC6, HDAC3, and acetylated histone H3 protein levels are significantly inhibited.
25305081 our results uncovered a mechanism by which PINK1-HDAC3 network mediates p53 inhibitory loop in response to oxidative stress-induced damage.
25301942 HDAC3 promotes TIP60 ubiquitination and cytoplasmic localization and protects cells from apoptosis after DNA damage.
25200321 These results demonstrate that mutant H3K27M can be specifically identified with high specificity and sensitivity using an H3K27M antibody and immunohistochemistry to detect high-grade astrocytomas.
25196196 dysbindin-1 formed a protein complex with HDAC3 in human neuroblastoma cells
25190803 XBP1u and HDAC3 exert a protective effect on disturbed flow-induced oxidative stress via up-regulation of mTORC2-dependent Akt1 phosphorylation and Nrf2-mediated HO-1 expression.
25144594 HDAC3, a new binding regulator of RCAN1, affects the protein stability and intracellular localization of RCAN1.
25138213 MiR-326 as a negative regulator of HDAC3.
25136952 HDAC3 is an essential target to disrupt HIV-1 latency, and inhibition of HDAC2 may also contribute to the effort to purge and eradicate latent HIV-1 infection.
25070540 Findings reveal strong expression of HDAC3 in patients with pancreatic cancer and suggest that HDAC3 participates in the pathogenesis and progression of pancreatic cancer.
24939842 PP1alpha and class I histone deacetylase (HDAC1/2/3) signaling pathways are essential for the stress-induced BRD4 release from chromatin.
24919179 c-Myc contributes to the epigenetic regulation of HPP1 via the dominant recruitment of HDAC3.
24811789 selective inhibition of HDAC3 may be an attractive strategy for targeting Type 1 and Type 2 diabetes
24760274 we further revealed that Stat3 could directly bind to the promoter region of Beclin 1 and repressed its transcription through recruiting histone deacetylase 3 (HDAC3).
24565863 Data show that Hdac3 physically interacts with Tbx5 and modulates its acetylation to repress Tbx5-dependent activation of cardiomyocyte lineage-specific genes.
24482232 KDM2A represses histone deacetylase 3 and has a role in tumorigenicity of lung cancer cells
24449765 model where p53 binding to the SMRT deacetylase activation domain (DAD) limits HDAC3 interaction with this coregulator, thereby facilitating SMRT coactivation of p53-dependent gene expression
24419085 A significant role for HDAC3 in the MYCN-mediated repression of GRHL1.
24324066 HDAC and DNMT protein expression were reduced when methylation-sensitive HCT 116 human colon cancer cells was treated with EGCG, but was relatively stable in the HT-29 cell line
24286324 The nuclear localization signal domain of HDAC3 was necessary, and sufficient for the binding of HDAC3 to the MDR1 promoter sequences
24286308 It show the novel role of HDAC3 as a negative regulator of angiogenesis.
24120624 results suggest that variants of HDAC3 contribute to an increased prevalence of type 2 diabetes mellitus in the Chinese Han population
24045946 HD3alpha directly interacts with HDAC3 and Akt1 and selectively activates transforming growth factor beta2 (TGFbeta2) secretion and cleavage.
23904210 study reports a single mutation of HDAC3 that is capable of mimicking the stabilizing effects of deacetylase-activating domain (DAD)and inositol tetraphosphate, without the presence of either. This mutation, however, results in a total loss of deacetylase activity
23879963 HDAC3 plays a critical role in regulating self-renewal of liver CSCs.
23857786 our study has found no association between HDAC2/HDAC3 gene polymorphisms and schizophrenia in the Chinese Han population
23760262 HDAC3 regulates cyclin A stability.
23685192 HDAC3 participated in the pathogenesis of children gliomas by promoting glioma cell proliferation and migration
23615070 Data indicate there was a link between baseline viral load, age (40 years), IL-28B (rs12979860), HDAC2 (rs3778216), HDAC3 (rs976552) and HDAC5 (rs368328) with sustained virological response (SVR).
23402757 HDAC3 is necessary for ERalpha mRNA stability, and is involved in the estrogen-dependent proliferation of ERalpha-positive tumors.
23395002 Hypoxia-induced histone deacetylase 3 repressed lncRNA-LET by reducing the histone acetylation-mediated modulation of the lncRNA-LET promoter region.
23079660 demonstrate that miR-29 is repressed by MYC through a corepressor complex with HDAC3 and EZH2
22796363 Suggest that ethanol affects 5-HT3 and serotonin through mechanisms involving neuronal HDAC1/3.
22763818 Histone deacetylase 3 inhibits expression of PUMA in gastric cancer cells; patients with low PUMA expression have significant decreases in overall survival.
22685561 Data indicate that reversal of histone H3K9/K14 acetylation by histone deacetylase 3 (HDAC3) is required for attenuation of interferon-A (IFN-A) gene transcription during viral infection.
22651256 analysis of regulation of small ubiquitin-like modifier-1, nuclear receptor coreceptor, histone deacetylase 3, and peroxisome proliferator-activated receptor-gamma in human adipose tissue
22647876 Prox1 recruits the corepressor HDAC3 to directly repress Nkx2.5 via a proximal upstream enhancer as a mechanism for regulating Nkx2.5 function in adult cardiac conduction.
22641068 In hepatocellular carcinoma cells, up-regulation of HDAC1-3 reduces expression of miR-449, activating hepatocyte growth factor and altering tumor growth.
22455388 HDAC3 knockdown promotes expansion of CD34+ cells without affecting monocyte lineage commitment.
22363205 Chemical inhibition or RNAi knockdown of HDAC3 in human SVG-A cells suppresses DNA trinucleotide repeat expansions.
22349439 PCOS rat models also showed alterations of PPARG1, NCOR1, and HDAC3 mRNA expression and methylation changes of PPARG1 and NCOR1, consistent with the results from humans.
22337871 The formation of a stable and active HDAC3-corepressor complex is a stepwise process in which the C terminus of HDAC3 plays a critical role at late steps of the assembly process.
22230954 the structure of a complex between an HDAC and a co-repressor, namely, human HDAC3 with the deacetylase activation domain (DAD) from the human SMRT co-repressor (also known as NCOR2)
22190034 HIV-1 Vif is identified to have a physical interaction with histone deacetylase 3 (HDAC3) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22027828 HDAC3 regulates galectin-9 expression in endothelial cells via interaction with PI3K-IRF3 signal pathway
22002311 The findings highlighted the role of HDAC3 in Myc-induced miR-15a/16-1 changes and reveal novel mechanisms for c-Myc-driven microRNA suppression and malignant transformation in aggressive B-cell malignancies.
21972094 Report HDAC3 expression in histological subtypes of testicular germ cell tumours.
21453528 HDAC3, not HDAC2, interacts with the major immediate early locus of human cytomegalovirus.
21346816 the role of HDAC3 and expression of p53 in T cells
21324898 HDAC3 and HDAC7 have opposite effects on osteoclast differentiation.(
21206745 HDAC3 plays a significant role in regulating tumor cell proliferation and invasion, and it could be served as a candidate biomarker for predicting the recurrence of hepatitis B virus-associated hepatocellular carcinoma following liver transplantation
21179472 a pathway through which Chk1 inhibition can mediate HDACi-induced mitotic entry and cell death
21143702 We immunohistochemically analyzed the expression of NCOR1 and 2 as well as HDAC1, 2, and 3 on a tissue microarray comprising tumor samples from 283 astrocytic gliomas
21059642 RUNX1 interacts with endogenous HDAC1 or HDAC3
21030595 HDAC3 is negatively regulated by the nuclear protein DBC1
20731616 combined analysis of HDAC1 SNP rs1741981 and HDAC3 SNP rs2547547 may be a potential genetic marker for hepatocellular carcinoma recurrence in liver transplantation patients.
20731616 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20563766 Strong tumoral expression of HDAC3 is an independent predictor of a poor prognosis in patients with adenocarcinoma of the lung
20473547 These findings suggest that HDAC3 selectively represses CREB3-mediated transcriptional activation and chemotactic signalling in human metastatic breast cancer cells.
20471694 The results suggest that HDAC3 genes might play a role in the pathophysiology of schizophrenia in a Korean population.
20471694 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20415600 HDAC isoforms 1, 2 and 3 are highly expressed in Hodgkin's lymphoma
20200160 Down-regulation of PROS1 gene expression by 17beta-estradiol via estrogen receptor alpha (ERalpha)-Sp1 interaction recruiting receptor-interacting protein 140 and the corepressor-HDAC3 complex.
20049841 results suggested that HDAC1 plays an important role in the proliferation of ovarian cancer cells, whereas HDAC3 functions in cell adhesion and migration
20026773 HDAC3 serves as an essential prosurvival molecule with a critical role in maintaining the endothelial integrity via Akt activation
19956841 apicidin acts as an effective anti-tumor agent on human endometrial cancer cells by regulating cell proliferation and apoptosis through the down-regulation of HDAC3 and HDAC4
19912635 High expression of HDAC1, HDAC2 and HDAC3 was significantly correlated with increased nuclear translocation of RelA/p65 in pancreatic cancer.
19855430 Studies discuss functional roels of histone deacetylases in the transcriptional regulation of genes involved in the inflammatory response.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19341714 Ski can stabilize RARalpha and HDAC3 thus Ski represses retinoic acid signaling by stabilizing corepressor complex.
19121623 These results indicate that HDAC3 may act as a scaffold protein for PP2A to regulate the LIF/STAT3-mediated signaling pathway.
19099586 findings show class I HDAC isoforms 1 and 2 are highly expressed in renal cell cancer, while HDAC 3 shows low, histology dependent expression rates
19032343 These results indicate that Ski complexes serve to maintain a TGF-beta-responsive promoter at a repressed basal level via the activities of histone deacetylase and histone arginine methyltransferase.
19015268 P/CAF deacetylation by HDAC3 and in a minor degree by HDAC1, HDAC2, or HDAC4 leads to cytoplasmic accumulation of P/CAF.
18832068 role of histone deacetylase 3 (HDAC3) in sister chromatid cohesion and the deacetylation of histone H3 Lys 4 (H3K4) at the centromere
18789002 Studies show that cancer cells effectively maintain low levels of pyruvate to prevent inhibition of HDAC1/HDAC3 and thereby to evade cell death.
18769117 HDAC3 overexpression alters the epigenetic programming of colon cancer cells to impact intracellular Wnt signaling and their sensitivity to external growth regulation by vitamin D
18542060 C-terminal region of p300 provides corepressor function and facilitates the recruitment of p300 and HDAC3 to the YY1-binding site and represses the c-Myc promoter.
18523274 Accessible chromatin-associated (histone 3 lysine 9) acetylation state serves as a cornerstone for differentially high expression of effector gene eomesodermin and its target genes perforin 1 and granzyme B in memory CD8 T cells.
18403372 growth factors inhibit sumoylation of SREBPs through their phosphorylation, thus avoiding the recruitment of an HDAC3 corepressor complex and stimulating the lipid uptake and synthesis required for cell growth.
18347167 Strong prognostic impact of HDAC isoforms in colorectal cancer.
18326024 HDAC3 complex is involved in the formation of functional mitotic spindles and proper kinetochore-microtubule attachment
18212746 we showed that the known effects of HDACs on differentiation and proliferation of cancer cells observed in vitro can also be confirmed in vivo.
18097041 pro-IL-16 forms a complex with GABPbeta1 and HDAC3 in suppressing the transcription of Skp2.
17956871 Runx2 and HDAC3 repress BSP gene expression and that this repression is suspended upon osteoblastic cell differentiation.
17925399 the transcription factor YY1 binds to and recruits HDAC3 to the lanosterol synthase promoter.
17908689 KLF4 might function as an activator or repressor of transcription depending on whether it interacts with co-activators such as p300 and CREB-binding protein or co-repressors such as HDAC3.
17849419 data support a central role for HDAC3 in regulating the cell proliferation and differentiation of colon cancer cells and suggest a potential mechanism by which colon cancers may become resistant to luminal butyrate
17786334 High expression of HDAC3 is associated with cancer tissues
17675290 Histone deacetylase inhibitors transcriptionally inhibit agonist-induced tissue factor expression in endothelial cells and monocytes by a TF-kappaB- and HDAC3-dependent mechanism.
17158926 These results reveal an unexpected role for HDAC3 and suggest a novel pathway through which MEF2 activity is controlled in vivo.
17101790 HDAC-3 cleavage is crucial for efficient apoptosis induction because it allows the activation of some proapoptotic genes during apoptosis progression.
17008592 HDAC3 plays a significant role in the regulation of TNF-alpha-mediated VCAM-1 expression
17007107 HDAC3 expression is elevated in human astrocytic tumours and its expression pattern is deregulated at the cellular level in high-grade gliomas.
16980585 HDAC3 is a critical, transcription-independent regulator of mitosis.
16849648 beta-globin gene promoters in GM979 cells and in erythroid progenitors demonstrate that RB7 and butyrate induce dissociation of HDAC3.
16730330 Results provide evidence to show that the HDAC3/N-CoR co-repressor complex is involved in the aberrant transcription regulation in PML-RARalpha-expressing cells.
16712523 This study shows that SMRT/NCoR-HDAC3 complex is a cofactor of CNOT2-mediated repression and suggest that transcriptional regulation by the Ccr4-Not complex involves regulation of chromatin modification.
16432238 PML-RARalpha functions by recruiting an HDAC3-MBD1 complex that contributes to the establishment and maintenance of the silenced chromatin state
16298343 the inhibition of p15(INK4b) and p21(WAF1/cip1) may be one of the mechanisms by which HDAC3 participates in cell cycle regulation and oncogenesis
16249187 when complexed with Smad6, silences transcriptional activity of glucocorticoid receptor
16129885 Data show that LAP2beta interacts at the nuclear envelope with HDAC3, a class-I histone deacetylase, and that TSA (an HDAC inhibitor) abrogates LAP2beta's transcriptional repressive activity.
16022908 Elevated HDAC3 expression is associated with squamous cell lung carcinomas
15917248 Repression of Dlk1 requires HDAC3 deacetylase activity, which is recruited to the endogenous Dlk1 promoter where it interacts with KLF6. The interaction between HDAC3 and KLF6 is identified as a potential mechanism underlying adipogenesis.
15761026 the N-CoR/HDAC3 complex has a role in regulating the expression of genes involved in circadian rhythm by functioning as corepressor for Rev-erbalpha
15572445 CMV IE1 interacts specifically with HDAC3 within infected cells, fundamental to transcriptional activation by IE1
15561719 THAP7 coimmunoprecipitates with histone deacetylase 3 and the nuclear hormone receptor corepressor and represses transcription
15356147 HDAC3 interacts directly and selectively with MAPK11/p38 beta isoform, represses ATF-2 transcriptional activity, and acts as a regulator of tumor necrosis factor gene expression in lipopolysaccharide-stimulated cells, especially in mononuclear phagocytes.
15292260 HDAC3 regulates osteoblast differentiation and bone formation; data show that HDAC3 actively regulates the transcriptional activity of the osteoblast master protein, Runx2.
12943985 the zinc fingers of nuclear receptors provide a general interaction interface for HDACs 3 and 4, recruiting HDACs 3 and 4 to the target DNA causing demonstrable histone deacetylation
12861000 N-CoR/histone deacetylase 3 complex is required for repression by thyroid hormone receptor
12853483 c-Jun phosporylation mediates dissociation of an inhibitory complex associated with HDAC3.
11931768 Results show that the N-CoR-HDAC3 complex inhibits JNK activation through the associated GPS2 subunit and thus could potentially provide an alternative mechanism for hormone-mediated antagonism of AP-1 function.
11867539 Non-permissive cells contain the class I HDAC, HDAC3; super-expression of HDAC3 in normally permissive cells reduces infection and MIEP activity.

AA Sequence

MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFL      1 - 70
QRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFE     71 - 140
ASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVG    141 - 210
AESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECV    211 - 280
EYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQN    281 - 350
SRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDN    351 - 420
DKESDVEI                                                                  421 - 428
//

Text Mined References (221)

PMID Year Title
26704017 2016 C/EBP? negatively regulates SIRT7 expression via recruiting HDAC3 to the upstream-promoter of hepatocellular carcinoma cells.
26663086 2016 Mitotic Activation of a Novel Histone Deacetylase 3-Linker Histone H1.3 Protein Complex by Protein Kinase CK2.
26542778 2015 HDAC3 role in medication consumption in medication overuse headache patients: a pilot study.
26531724 2016 Role of histone deacetylase 3 in ankylosing spondylitis via negative feedback loop with microRNA-130a and enhancement of tumor necrosis factor-1? expression in peripheral blood mononuclear cells.
26450925 2015 Histone deacetylase 3 indirectly modulates tubulin acetylation.
26420860 2015 The Metabolic Regulator Histone Deacetylase 9 Contributes to Glucose Homeostasis Abnormality Induced by Hepatitis C Virus Infection.
26359372 2015 Aberrant expression and activity of histone deacetylases in sporadic idiopathic pulmonary fibrosis.
26305553 2015 Histone Deacetylase 3 and 4 Complex Stimulates the Transcriptional Activity of the Mineralocorticoid Receptor.
25997740 2015 miR-335 Targets SIAH2 and Confers Sensitivity to Anti-Cancer Drugs by Increasing the Expression of HDAC3.
25973054 2015 Increased HDAC3 and decreased miRNA-130a expression in PBMCs through recruitment HDAC3 in patients with spinal cord injuries.
25940092 2015 Histone deacetylase 3 expression correlates with vasculogenic mimicry through the phosphoinositide3-kinase / ERK-MMP-laminin5?2 signaling pathway.
25892518 2015 PML suppresses IL-6-induced STAT3 activation by interfering with STAT3 and HDAC3 interaction.
25678599 2015 The Tumor-Suppressor WWOX and HDAC3 Inhibit the Transcriptional Activity of the ?-Catenin Coactivator BCL9-2 in Breast Cancer Cells.
25644061 2015 SOX4 interacts with EZH2 and HDAC3 to suppress microRNA-31 in invasive esophageal cancer cells.
25623232 2015 ZBP-89 reduces histone deacetylase 3 by degrading IkappaB in the presence of Pin1.
25610877 2014 The class I histone deacetylase inhibitor MS-275 prevents pancreatic beta cell death induced by palmitate.
25380050 2014 Differential effect of HDAC3 on cytoplasmic and nuclear huntingtin aggregates.
25307283 2015 The effect of sulforaphane on histone deacetylase activity in keratinocytes: Differences between in vitro and in vivo analyses.
25305081 2015 PINK1 positively regulates HDAC3 to suppress dopaminergic neuronal cell death.
25301942 2014 Regulation of histone acetyltransferase TIP60 function by histone deacetylase 3.
25200321 2014 Specific detection of methionine 27 mutation in histone 3 variants (H3K27M) in fixed tissue from high-grade astrocytomas.
25196196 2014 Dysbindin-1, a schizophrenia-related protein, interacts with HDAC3.
25190803 2014 Unspliced X-box-binding protein 1 (XBP1) protects endothelial cells from oxidative stress through interaction with histone deacetylase 3.
25144594 2014 Histone deacetylase 3 promotes RCAN1 stability and nuclear translocation.
25138213 2014 miR-326-histone deacetylase-3 feedback loop regulates the invasion and tumorigenic and angiogenic response to anti-cancer drugs.
25136952 2014 Selective HDAC inhibition for the disruption of latent HIV-1 infection.
25070540 2014 Histone deacetylase 3 promotes pancreatic cancer cell proliferation, invasion and increases drug-resistance through histone modification of P27, P53 and Bax.
24939842 2014 Histone cross-talk connects protein phosphatase 1? (PP1?) and histone deacetylase (HDAC) pathways to regulate the functional transition of bromodomain-containing 4 (BRD4) for inducible gene expression.
24919179 2014 The interplay between histone deacetylases and c-Myc in the transcriptional suppression of HPP1 in colon cancer.
24811789 2014 Inhibition of HDAC3 as a strategy for developing novel diabetes therapeutics.
24760274 2014 Stat3 inhibits Beclin 1 expression through recruitment of HDAC3 in nonsmall cell lung cancer cells.
24565863 2014 Histone deacetylase 3 modulates Tbx5 activity to regulate early cardiogenesis.
24482232 2014 Transcriptional repression of histone deacetylase 3 by the histone demethylase KDM2A is coupled to tumorigenicity of lung cancer cells.
24449765 2014 Activation of p53 transcriptional activity by SMRT: a histone deacetylase 3-independent function of a transcriptional corepressor.
24419085 2014 GRHL1 acts as tumor suppressor in neuroblastoma and is negatively regulated by MYCN and HDAC3.
24324066 2013 Green tea polyphenol epigallocatechin 3-gallate, contributes to the degradation of DNMT3A and HDAC3 in HCT 116 human colon cancer cells.
24286324 2014 Nuclear localization signal domain of HDAC3 is necessary and sufficient for the expression regulation of MDR1.
24286308 2014 HDAC3 acts as a negative regulator of angiogenesis.
24120624 2014 Three single nucleotide variants of the HDAC gene are associated with type 2 diabetes mellitus in a Chinese population: a community-based case-control study.
24045946 2013 Histone deacetylase 3 unconventional splicing mediates endothelial-to-mesenchymal transition through transforming growth factor ?2.
23911289 2013 A hybrid mechanism of action for BCL6 in B cells defined by formation of functionally distinct complexes at enhancers and promoters.
23904210 2013 Inactivating mutation in histone deacetylase 3 stabilizes its active conformation.
23879963 2013 Histone deacetylase 3 participates in self-renewal of liver cancer stem cells through histone modification.
23867755 2013 Involvement of Epac1/Rap1/CaMKI/HDAC5 signaling cascade in the regulation of placental cell fusion.
23857786 2013 Associations of histone deacetylase-2 and histone deacetylase-3 genes with schizophrenia in a Chinese population.
23760262 2013 Histone deacetylase 3 regulates cyclin A stability.
23752268 2013 The functional interactome landscape of the human histone deacetylase family.
23685192 2013 Histone deacetylase 3 implicated in the pathogenesis of children glioma by promoting glioma cell proliferation and migration.
23615070 Polymorphisms in histone deacetylases improve the predictive value of IL-28B for chronic hepatitis C therapy.
23402757 2013 HDAC3 regulates stability of estrogen receptor ? mRNA.
23395002 2013 Repression of the long noncoding RNA-LET by histone deacetylase 3 contributes to hypoxia-mediated metastasis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23079660 2012 Coordinated silencing of MYC-mediated miR-29 by HDAC3 and EZH2 as a therapeutic target of histone modification in aggressive B-Cell lymphomas.
22796363 2012 Alcohol-induced serotonergic modulation: the role of histone deacetylases.
22763818 2013 Histone deacetylase 3 inhibits expression of PUMA in gastric cancer cells.
22685561 2012 Recruitment of histone deacetylase 3 to the interferon-A gene promoters attenuates interferon expression.
22651256 2012 Regulation of small ubiquitin-like modifier-1, nuclear receptor coreceptor, histone deacetylase 3, and peroxisome proliferator-activated receptor-? in human adipose tissue.
22647876 2012 Epistatic rescue of Nkx2.5 adult cardiac conduction disease phenotypes by prospero-related homeobox protein 1 and HDAC3.
22641068 2012 Histone deacetylases activate hepatocyte growth factor signaling by repressing microRNA-449 in hepatocellular carcinoma cells.
22455388 2012 Histone deacetylase 3 modulates the expansion of human hematopoietic stem cells.
22363205 2012 Histone deacetylase complexes promote trinucleotide repeat expansions.
22349439 2012 A molecular mechanism underlying ovarian dysfunction of polycystic ovary syndrome: hyperandrogenism induces epigenetic alterations in the granulosa cells.
22337871 2012 Regulated clearance of histone deacetylase 3 protects independent formation of nuclear receptor corepressor complexes.
22230954 2012 Structure of HDAC3 bound to co-repressor and inositol tetraphosphate.
22190034 2011 Global landscape of HIV-human protein complexes.
22027828 2011 Galectin-9 protein expression in endothelial cells is positively regulated by histone deacetylase 3.
22002311 2012 Myc represses miR-15a/miR-16-1 expression through recruitment of HDAC3 in mantle cell and other non-Hodgkin B-cell lymphomas.
21972094 2011 Expression of histone deacetylases 1, 2 and 3 in histological subtypes of testicular germ cell tumours.
21914818 2011 A BEN-domain-containing protein associates with heterochromatin and represses transcription.
21453528 2011 Histone deacetylase 3, not histone deacetylase 2, interacts with the major immediate early locus of human cytomegalovirus.
21444723 2011 Acetylation of a conserved lysine residue in the ATP binding pocket of p38 augments its kinase activity during hypertrophy of cardiomyocytes.
21346816 2011 Role of HDAC3 on p53 expression and apoptosis in T cells of patients with multiple sclerosis.
21324898 2011 HDAC3 and HDAC7 have opposite effects on osteoclast differentiation.
21269460 2011 Initial characterization of the human central proteome.
21258344 2011 Chemoproteomics profiling of HDAC inhibitors reveals selective targeting of HDAC complexes.
21206745 2010 Identification of histone deacetylase 3 as a biomarker for tumor recurrence following liver transplantation in HBV-associated hepatocellular carcinoma.
21179472 2010 Histone deacetylase inhibitors downregulate checkpoint kinase 1 expression to induce cell death in non-small cell lung cancer cells.
21143702 2011 Expression of nuclear receptor corepressors and class I histone deacetylases in astrocytic gliomas.
21059642 2011 Phosphorylation of RUNX1 by cyclin-dependent kinase reduces direct interaction with HDAC1 and HDAC3.
21030595 2010 HDAC3 is negatively regulated by the nuclear protein DBC1.
20731616 2010 Combination of polymorphisms within the HDAC1 and HDAC3 gene predict tumor recurrence in hepatocellular carcinoma patients that have undergone transplant therapy.
20563766 2010 Strong expression of HDAC3 correlates with a poor prognosis in patients with adenocarcinoma of the lung.
20473547 2010 HDAC3 selectively represses CREB3-mediated transcription and migration of metastatic breast cancer cells.
20471694 2010 Association of histone deacetylase genes with schizophrenia in Korean population.
20415600 2010 Class I histone deacetylases 1, 2 and 3 are highly expressed in classical Hodgkin's lymphoma.
20385135 2010 Histone deacetylase 3 is selectively involved in L3MBTL2-mediated transcriptional repression.
20200160 2010 Down-regulation of PROS1 gene expression by 17beta-estradiol via estrogen receptor alpha (ERalpha)-Sp1 interaction recruiting receptor-interacting protein 140 and the corepressor-HDAC3 complex.
20049841 2010 Type-specific roles of histone deacetylase (HDAC) overexpression in ovarian carcinoma: HDAC1 enhances cell proliferation and HDAC3 stimulates cell migration with downregulation of E-cadherin.
20026773 2010 Histone deacetylase 3 is critical in endothelial survival and atherosclerosis development in response to disturbed flow.
19956841 2010 Anti-tumor effect of apicidin on Ishikawa human endometrial cancer cells both in vitro and in vivo by blocking histone deacetylase 3 and 4.
19912635 2009 High class I HDAC activity and expression are associated with RelA/p65 activation in pancreatic cancer in vitro and in vivo.
19855430 2010 Histone deacetylases and the immunological network: implications in cancer and inflammation.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19409814 2009 NKAP is a transcriptional repressor of notch signaling and is required for T cell development.
19341714 2009 The Ski protein can inhibit ligand induced RARalpha and HDAC3 degradation in the retinoic acid signaling pathway.
19121623 2009 HDAC3 influences phosphorylation of STAT3 at serine 727 by interacting with PP2A.
19099586 2008 Class I histone deacetylases 1, 2 and 3 are highly expressed in renal cell cancer.
19032343 2009 Ski co-repressor complexes maintain the basal repressed state of the TGF-beta target gene, SMAD7, via HDAC3 and PRMT5.
19015268 2009 Autoacetylation regulates P/CAF nuclear localization.
18854353 2008 The Cohesin loading factor NIPBL recruits histone deacetylases to mediate local chromatin modifications.
18832068 2008 Histone deacetylase 3 is required for centromeric H3K4 deacetylation and sister chromatid cohesion.
18789002 2009 Colon cancer cells maintain low levels of pyruvate to avoid cell death caused by inhibition of HDAC1/HDAC3.
18769117 2008 HDAC3 impacts multiple oncogenic pathways in colon cancer cells with effects on Wnt and vitamin D signaling.
18585351 2008 Ronin is essential for embryogenesis and the pluripotency of mouse embryonic stem cells.
18542060 2008 p300 provides a corepressor function by cooperating with YY1 and HDAC3 to repress c-Myc.
18523274 2008 Histone acetylation facilitates rapid and robust memory CD8 T cell response through differential expression of effector molecules (eomesodermin and its targets: perforin and granzyme B).
18417529 2008 Identification of an INSM1-binding site in the insulin promoter: negative regulation of the insulin gene transcription.
18403372 2008 Growth factor-induced phosphorylation of sterol regulatory element-binding proteins inhibits sumoylation, thereby stimulating the expression of their target genes, low density lipoprotein uptake, and lipid synthesis.
18347167 2008 Class I histone deacetylase expression has independent prognostic impact in human colorectal cancer: specific role of class I histone deacetylases in vitro and in vivo.
18326024 2008 Histone deacetylase 3 localizes to the mitotic spindle and is required for kinetochore-microtubule attachment.
18212746 2008 Histone deacetylases 1, 2 and 3 are highly expressed in prostate cancer and HDAC2 expression is associated with shorter PSA relapse time after radical prostatectomy.
18097041 2008 Pro-IL-16 recruits histone deacetylase 3 to the Skp2 core promoter through interaction with transcription factor GABP.
17956871 2007 Runx2- and histone deacetylase 3-mediated repression is relieved in differentiating human osteoblast cells to allow high bone sialoprotein expression.
17925399 2007 Histone deacetylase 3 down-regulates cholesterol synthesis through repression of lanosterol synthase gene expression.
17908689 2007 Kruppel-like factor 4 is acetylated by p300 and regulates gene transcription via modulation of histone acetylation.
17849419 2008 HDAC3 overexpression and colon cancer cell proliferation and differentiation.
17786334 2007 Expression profile of class I histone deacetylases in human cancer tissues.
17785205 2007 LZAP, a putative tumor suppressor, selectively inhibits NF-kappaB.
17675290 2007 Histone deacetylase inhibitors suppress TF-kappaB-dependent agonist-driven tissue factor expression in endothelial cells and monocytes.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17172643 2007 Multiple histone deacetylases and the CREB-binding protein regulate pre-mRNA 3'-end processing.
17158926 2007 Histone deacetylase 3 interacts with and deacetylates myocyte enhancer factor 2.
17101790 2007 Cleavage and cytoplasmic relocalization of histone deacetylase 3 are important for apoptosis progression.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17053781 2006 Suppression of receptor interacting protein 140 repressive activity by protein arginine methylation.
17008592 2006 Histone deacetylase inhibitor reduces monocyte adhesion to endothelium through the suppression of vascular cell adhesion molecule-1 expression.
17007107 2006 Elevated and deregulated expression of HDAC3 in human astrocytic glial tumours.
16980585 2006 A novel histone deacetylase pathway regulates mitosis by modulating Aurora B kinase activity.
16924111 2006 A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells.
16919237 2006 Breast cancer metastasis suppressor 1 (BRMS1) is stabilized by the Hsp90 chaperone.
16849648 2006 Short-chain fatty acids induce gamma-globin gene expression by displacement of a HDAC3-NCoR repressor complex.
16847267 2006 MAGE-A tumor antigens target p53 transactivation function through histone deacetylase recruitment and confer resistance to chemotherapeutic agents.
16730330 2006 Histone deacetylase 3 (HDAC3) is recruited to target promoters by PML-RARalpha as a component of the N-CoR co-repressor complex to repress transcription in vivo.
16712523 2006 Involvement of the SMRT/NCoR-HDAC3 complex in transcriptional repression by the CNOT2 subunit of the human Ccr4-Not complex.
16569215 2006 INSM1 functions as a transcriptional repressor of the neuroD/beta2 gene through the recruitment of cyclin D1 and histone deacetylases.
16528103 2006 Histone deacetylase 3 binds to and regulates the GCMa transcription factor.
16432238 2006 The methyl-CpG binding protein MBD1 is required for PML-RARalpha function.
16298343 2006 Histone deacetylase 3 represses p15(INK4b) and p21(WAF1/cip1) transcription by interacting with Sp1.
16249187 2005 The Smad6-histone deacetylase 3 complex silences the transcriptional activity of the glucocorticoid receptor: potential clinical implications.
16129885 2005 The nuclear-envelope protein and transcriptional repressor LAP2beta interacts with HDAC3 at the nuclear periphery, and induces histone H4 deacetylation.
16033423 2005 The POZ/BTB protein NAC1 interacts with two different histone deacetylases in neuronal-like cultures.
16022908 2005 Comparative application of antibody and gene array for expression profiling in human squamous cell lung carcinoma.
15927959 2005 Functional characterization of JMJD2A, a histone deacetylase- and retinoblastoma-binding protein.
15917248 2005 Krüppel-like factor-6 promotes preadipocyte differentiation through histone deacetylase 3-dependent repression of DLK1.
15805470 2005 Histone deacetylase 3 (HDAC3) activity is regulated by interaction with protein serine/threonine phosphatase 4.
15761026 2005 The orphan nuclear receptor Rev-erbalpha recruits the N-CoR/histone deacetylase 3 corepressor to regulate the circadian Bmal1 gene.
15653507 2005 Stat3 dimerization regulated by reversible acetylation of a single lysine residue.
15572445 2004 Human cytomegalovirus immediate-early 1 protein facilitates viral replication by antagonizing histone deacetylation.
15561719 2005 Human THAP7 is a chromatin-associated, histone tail-binding protein that represses transcription via recruitment of HDAC3 and nuclear hormone receptor corepressor.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15469820 2004 GSK3-mediated BCL-3 phosphorylation modulates its degradation and its oncogenicity.
15356147 2004 Histone deacetylase 3, a class I histone deacetylase, suppresses MAPK11-mediated activating transcription factor-2 activation and represses TNF gene expression.
15333839 2004 E protein silencing by the leukemogenic AML1-ETO fusion protein.
15297880 2004 Regulation of human SRY subcellular distribution by its acetylation/deacetylation.
15292260 2004 Histone deacetylase 3 interacts with runx2 to repress the osteocalcin promoter and regulate osteoblast differentiation.
15194749 2004 Functional interaction between class II histone deacetylases and ICP0 of herpes simplex virus type 1.
15184363 2004 Identification of a novel family of ankyrin repeats containing cofactors for p160 nuclear receptor coactivators.
15016912 2004 Ataxin 1, a SCA1 neurodegenerative disorder protein, is functionally linked to the silencing mediator of retinoid and thyroid hormone receptors.
14684825 2003 Genome-wide survey of human alternative pre-mRNA splicing with exon junction microarrays.
14633989 2003 Role of acetylated human AP-endonuclease (APE1/Ref-1) in regulation of the parathyroid hormone gene.
14525983 2003 DACH1 inhibits transforming growth factor-beta signaling through binding Smad4.
14521922 2003 Identification of histone deacetylase-3 domains that interact with the orphan nuclear receptor TR2.
12972430 2003 Cytoplasmic IkappaBalpha increases NF-kappaB-independent transcription through binding to histone deacetylase (HDAC) 1 and HDAC3.
12943985 2003 Interaction of nuclear receptor zinc finger DNA binding domains with histone deacetylase.
12861000 2003 The N-CoR/histone deacetylase 3 complex is required for repression by thyroid hormone receptor.
12853483 2003 JNK phosphorylation relieves HDAC3-dependent suppression of the transcriptional activity of c-Jun.
12711221 2003 Class II histone deacetylases: versatile regulators.
12628926 2003 Purification and functional characterization of the human N-CoR complex: the roles of HDAC3, TBL1 and TBLR1.
12590135 2003 The histone deacetylase 9 gene encodes multiple protein isoforms.
12502735 2002 Assembly of the SMRT-histone deacetylase 3 repression complex requires the TCP-1 ring complex.
12479814 2002 The retinoblastoma-histone deacetylase 3 complex inhibits PPARgamma and adipocyte differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12419806 2003 Post-activation turn-off of NF-kappa B-dependent transcription is regulated by acetylation of p65.
12393887 2003 Histone deacetylase 3 binds to and regulates the multifunctional transcription factor TFII-I.
12371150 2002 Control of the cell cycle by neurotrophins: lessons from the p75 neurotrophin receptor.
12242670 2002 The transcriptional corepressor MTG16a contains a novel nucleolar targeting sequence deranged in t (16; 21)-positive myeloid malignancies.
12239342 2002 Physical and functional interactions of histone deacetylase 3 with TFII-I family proteins and PIASxbeta.
12150997 2002 Exchange of N-CoR corepressor and Tip60 coactivator complexes links gene expression by NF-kappaB and beta-amyloid precursor protein.
12048199 2002 Cyclin D1 Is a Ligand-independent Co-repressor for Thyroid Hormone Receptors.
12032081 2002 The SUMO E3 ligase RanBP2 promotes modification of the HDAC4 deacetylase.
11931768 2002 The N-CoR-HDAC3 nuclear receptor corepressor complex inhibits the JNK pathway through the integral subunit GPS2.
11923873 2002 Bop encodes a muscle-restricted protein containing MYND and SET domains and is essential for cardiac differentiation and morphogenesis.
11867749 2002 The peroxisome proliferator-activated receptor delta, an integrator of transcriptional repression and nuclear receptor signaling.
11861901 2002 Identification of HDAC10, a novel class II human histone deacetylase containing a leucine-rich domain.
11804585 2002 Enzymatic activity associated with class II HDACs is dependent on a multiprotein complex containing HDAC3 and SMRT/N-CoR.
11788710 2002 Functional and physical interaction between the histone methyl transferase Suv39H1 and histone deacetylases.
11779848 2002 Functional domains of histone deacetylase-3.
11777905 2002 Human class I histone deacetylase complexes show enhanced catalytic activity in the presence of ATP and co-immunoprecipitate with the ATP-dependent chaperone protein Hsp70.
11641275 2001 The hairless gene mutated in congenital hair loss disorders encodes a novel nuclear receptor corepressor.
11641274 2001 FIH-1: a novel protein that interacts with HIF-1alpha and VHL to mediate repression of HIF-1 transcriptional activity.
11567998 2001 Histone deacetylase 3 associates with and represses the transcription factor GATA-2.
11533489 2001 Duration of nuclear NF-kappaB action regulated by reversible acetylation.
11533236 2001 ETO, a target of t(8;21) in acute leukemia, makes distinct contacts with multiple histone deacetylases and binds mSin3A through its oligomerization domain.
11509652 2001 The SMRT and N-CoR corepressors are activating cofactors for histone deacetylase 3.
11470869 2001 The histone deacetylase HDAC3 targets RbAp48 to the retinoblastoma protein.
11466315 2001 Human HDAC7 histone deacetylase activity is associated with HDAC3 in vivo.
11463856 2001 The orphan nuclear receptor TR2 interacts directly with both class I and class II histone deacetylases.
11302704 2001 Homo-oligomerisation and nuclear localisation of mouse histone deacetylase 1.
11259576 2001 The growth suppressor PML represses transcription by functionally and physically interacting with histone deacetylases.
11013263 2000 A novel nuclear receptor corepressor complex, N-CoR, contains components of the mammalian SWI/SNF complex and the corepressor KAP-1.
11006275 2000 Receptor-interacting protein 140 directly recruits histone deacetylases for gene silencing.
10983972 2000 Regulation of skeletal myogenesis by association of the MEF2 transcription factor with class II histone deacetylases.
10944117 2000 Both corepressor proteins SMRT and N-CoR exist in large protein complexes containing HDAC3.
10898795 2000 BCoR, a novel corepressor involved in BCL-6 repression.
10869435 2000 Regulation of histone deacetylase 4 and 5 and transcriptional activity by 14-3-3-dependent cellular localization.
10860984 2000 The histone deacetylase-3 complex contains nuclear receptor corepressors.
10809664 2000 A core SMRT corepressor complex containing HDAC3 and TBL1, a WD40-repeat protein linked to deafness.
10777477 2000 Histone deacetylases specifically down-regulate p53-dependent gene activation.
10669754 2000 Sequestration and inhibition of Daxx-mediated transcriptional repression by PML.
10655483 2000 Identification of a transcriptional repressor related to the noncatalytic domain of histone deacetylases 4 and 5.
10581039 1999 Transcriptional repression mediated by the human polycomb-group protein EED involves histone deacetylation.
10575214 1999 High resolution physical mapping of human HDAC3, a potential tumor suppressor gene in the 5q31 region.
10490602 1999 RBP1 recruits both histone deacetylase-dependent and -independent repression activities to retinoblastoma family proteins.
10220385 1999 Three proteins define a class of human histone deacetylases related to yeast Hda1p.
10051405 1999 Genomic organization and chromosomal localization of the human histone deacetylase 3 gene.
9722949 1998 Identification and mapping of human histone acetylation modifier gene homologues.
9501169 1998 Characterization of a human RPD3 ortholog, HDAC3.
9464271 1998 Differential display cloning of a novel human histone deacetylase (HDAC3) cDNA from PHA-activated immune cells.
9360932 1997 Nonsyndromic deafness DFNA1 associated with mutation of a human homolog of the Drosophila gene diaphanous.
9346952 1997 Isolation and characterization of cDNAs corresponding to an additional member of the human histone deacetylase gene family.