Property Summary

NCBI Gene PubMed Count 288
PubMed Score 528.78
PubTator Score 373.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
sonic hedgehog group medulloblastoma 1.900 9.1e-09
medulloblastoma, large-cell 1.600 4.6e-05
primitive neuroectodermal tumor 1.400 2.2e-04
lung cancer 1.700 2.4e-05
ovarian cancer 2.200 3.6e-06

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
651926 confirmatory 0 / 0 / 1 ML327 E-Cadherin HDAC Spectrum Assay_HDAC2

Gene RIF (166)

PMID Text
26846508 our study revealed that HDAC2 is overexpressed in colorectal cancer (CRC) cells; its knockdown can increase the sensitivity of CRC cells to doxorubicin via upregulation of ABCB1
26815200 Endothelial-Mesenchymal Transition is initiated by recruitment of aberrantly phosphorylated DNMT1 to the RASAL1 CpG island promoter by HDAC2, causing aberrant promoter methylation and transcriptional suppression.
26683361 Decreased HDAC2 expression is associated with cisplatin resistance in ovarian cancer.
26617781 In cigarette smoke extract-exposed airway epithelial cells and macrophages, HDAC2 is excessively ubiquitinated and degraded in the proteasome attributed to low expression of USP17.
26502922 Pancreatic adenocarcinoma patients with enhanced HDAC-1 and -6 expression showed significantly longer survival times compared to those with low expression, while a borderline association concerning HDAC-2 expression was noted.
26498345 Lymphocyte senescence in COPD is associated with loss of HDAC2 in CD28nullCD8+ T and NKT-like cells.
26359372 Aberrant overexpression of HDACs in basal cells of IPF lungs may contribute to the bronchiolisation process in this disease. Similarly, generation and apoptosis resistance of IPF fibroblasts are mediated by enhanced activity of HDAC enzymes.
26255936 simultaneous depletion of HDAC1/2 compromises the deacetylation of H3K56Ac, while depletion of HDAC1 or HDAC2 alone has no effect on H3K56Ac.
26116233 Results show that mRNA expression of histone deacetylases HDAC1 and HDAC2 were significantly increased in peripheral blood mononuclear cells of patients with with Graves' disease compared to controls.
26063464 HDAC2 may not confer susceptibility to Schizophrenia in Han Chinese.
25942572 Histone deacetylases 1 and 2 have roles in regulating DNA replication and DNA repair in cancer [review]
25808664 Inactivation of HDAC1 or HDAC2 induces gamma-globin expression without altering cell cycle or proliferation.
25704882 HDAC2 sumoylation is important for NF-kappaB-dependent gene expression and for the resistance of cell against stress
25697359 Data suggest that p15RS (p15INK4b-related sequence) acts as an intrinsic transcriptional repressor for Wnt/beta-catenin-mediated gene transcription through recruiting HDAC2 histone deacetylase.
25688158 shRNA-mediated knockdown of HDAC1 or HDAC2 resulted in growth inhibition of B-cell acute lymphoblastic leukemia cells.
25655932 In endothelial dysfunction, HDAC2 levels were reciprocally regulated by ectopic expression of NEDD8 and the de-NEDDylating enzyme SENP8.
25605253 Selective inhibition of HDAC2 in lung tumor cell causes survivin downregulation through activation of p53, which is mediated by downregulation of Mdm2.
25523932 HDAC2 inhibition reduces proliferation and induces apoptosis via the caspase-dependent pathway in human glioma cell lines, possibly by activating the p53 signaling pathway.
25492968 HDAC2 plays a central role in coupling lysine acetylation to synaptic plasticity and mediates many of the effects of HDAC inhibition in cognition and disease.
25486475 BRG1/HDAC2 and beta-catenin constitute a manipulative apparatus at the transcription start site to play opposite but complementary roles in regulating hTERT expression.
25473896 Data indicate that that hstone deacetylase 2 (HDAC2) has a specific role in leukemogenesis.
25270209 Data indicate that the 20(S)-ginsenoside Rh2 [Rh2(S) can inhibit the proliferation of K562 cells and induce its cycle arrest and apoptosis through inhibiting histone deacetylases HDAC1 and HDAC2 activity.
25136952 HDAC3 is an essential target to disrupt HIV-1 latency, and inhibition of HDAC2 may also contribute to the effort to purge and eradicate latent HIV-1 infection.
25013374 our data suggested that cPA may have beneficial effects in inflammation-related cardiovascular disease by controlling HDAC2 regulation
24965412 The proliferation inhibition and cell cycle arrest mediated by downregulated HDAC2 expression may be tightly associated with the decrease of cyclin D1, cyclin E, and cdk2 proteins expression.
24958469 HDAC2 silencing in HCC cells also strongly inhibited PPARgamma signaling.
24939842 PP1alpha and class I histone deacetylase (HDAC1/2/3) signaling pathways are essential for the stress-induced BRD4 release from chromatin.
24833798 HDAC2 is a critical regulator of Arg2 expression and thereby endothelial nitric oxide and endothelial function.
24788349 inhibitory of cell growth by melittin might be led by HDAC2-mediated PTEN upregulation, Akt inactivation, and inhibition of the PI3K/Akt signaling pathways
24763403 Simultaneous loss of Hdac1 and Hdac2 resulted in loss of hematopoietic stem cells.
24616922 Data suggest that overexpression of CK2a (casein kinase 2, alpha) in liver promotes oncogenesis by mediating EGF/EGFR- (epidermal growth factor/EGF receptor)-induced HDAC2 (histone deacetylase 2) expression in hepatocarcinogenesis.
24448241 Growth factor-induced HDAC2 maintains mitogenic signaling and function during hepatocellular malignant progression.
24390319 these results indicated that the potential of specific inhibition of HDAC2 by small molecular chemicals may lead to future therapeutic agents in human renal cancer treatment.
24376786 nuclear targeting of MIER1alpha requires an intact ELM2 domain and is dependent on interaction with HDAC1/2
24239178 The transcriptional function of HCS was shown by in vitro pull down and in vivo co-immunoprecipitation assays to depend on its interaction with the histone deacetylases HDAC1, HDAC2 and HDAC7
24218540 HDAC2 is a target of colon cancer chemoprevention and polyposis models of intestinal tumorigenesis in F344 rats as well as in transgenic mice.
24105979 Osteocalcin levels were decreased, an effect induced at the transcriptional level, and were strongly correlated with inhibition of HDAC2.
24030221 Passive smoking impairs HDAC2 function via PI3K signaling activation, which could contribute to inflammation in children with severe asthma.
23975430 PELP1 regulates tumor metastasis by controlling the expression and functions of the tumor metastasis suppressors miR-200a and miR-141
23939379 The regulation of ATM by HDAC enzymes therefore suggests a vital role for HDAC1 and HDAC2 in the DNA damage response.
23926105 Co-transfection of KLF-4 and HDAC1,2 expression plasmids in breast cancer cells results in synergistic repression of VEGF
23891737 Expression of JHDM2A was significantly increased but HDAC2, HDAC7, and SUV39H2 were significantly down-regulated in Systemic Sclerosis B cells relative to controls
23857786 our study has found no association between HDAC2/HDAC3 gene polymorphisms and schizophrenia in the Chinese Han population
23831020 MTA1 acts as a potent corepressor of the nuclear receptor NR4A1 transcription by interacting with HDAC2 and may serve as a novel DTX-resistance promoter in PC-3 cells
23717666 suggest that airway HDAC2 expression is increased in the LP by smoking itself, but is reduced in COPD
23714156 show gender-specific transcriptional control of UGT1A genes in jejunum and colon, which is repressed by ERalpha and the recruitment of HDCA 1 and 2 to the UGT1A promoter sequence in females
23615070 Data indicate there was a link between baseline viral load, age (40 years), IL-28B (rs12979860), HDAC2 (rs3778216), HDAC3 (rs976552) and HDAC5 (rs368328) with sustained virological response (SVR).
23612983 Enzyme inhibition studies and mutational analyses demonstrated that protein kinase CK2-catalyzed phosphorylation of HDAC1 and -2 is crucial for the dissociation of these two enzymes.
23554474 The results og this study highlight a role for HDAC2 in suppressing synaptic excitation and enhancing synaptic inhibition of hippocampal neurons.
23544610 the inhibitory effect of TSA on cancer invasion is mediated through the suppression of HDAC2 expression, and the reduction of MMP-2 and MMP-9 expression induced by HDAC2 may be involved in the anti-invasive effect of TSA
23499894 we suggest that loss or suppression of miR-145 may cause aberrant overexpression of HDAC2 and promote hepatocellular carcinoma tumorigenesis.
23440245 Hdac2 acts oncosuppressive in the early stages, and oncogenic in established tumor cells.
23280436 HDAC1 and 2 corepressor complexes are removed from the mitotic chromosomes and are available early in the events leading to the re-establishment of the gene expression program in daughter cells.
23275209 HDAC2 levels may serve as a promising, easily detected biomarker of chronic obstructive pulmonary diseases.
23251689 The majority of classes I and II HDACs were detected in the pancreatic cancer cell lines.
23242568 Studied HDAC2 expression of archival tissues of patients eho underwent resection for primary gallbladder carcinoma; results show high HDAC2 expression is an independent prognostic factor for both overall and disease-free survival of patients with PGC.
23195070 HDAC2 is a regulator of SERT gene expression in intestinal epithelial cells.
23175521 Expression of p16(INK4a) was restored by HDAC2 knockdown with notable histone-H4-acetylation, as determined by chromatin-IP. p16(INK4a) is regulated by HDAC2.
23110995 X-radiation and siRNA inhibit expression of HDAC1 and HDAC2, weaken the inhibitory effect of HDAC on Axin, upregulate Axin expression and induce apoptosis of lung cancer cells
22944197 Data indicate prominent changes in urothelial cancer cell lines (UCC) were HDAC2 and/or HDAC8 up-regulation.
22932458 Down-regulation of HDAC2 expression mediates proliferation inhibition and cell cycle arrest in HeLa cells.
22932408 HDAC2 may play a pivotal role in the initiation and development of laryngeal squamous cell carcinoma. Down-regulation of HDAC2 expression mediates cell apoptosis.
22798432 glucocorticoid receptor and HDAC2 are recruited to the MUC5AC promoter and mediate the glucocorticoid repression of MUC5AC gene expression.
22641068 In hepatocellular carcinoma cells, up-regulation of HDAC1-3 reduces expression of miR-449, activating hepatocyte growth factor and altering tumor growth.
22493095 new molecular mechanism involving a dynamically controlled HDAC2-sumoylation/p53-acetylation switch that regulates cell fate decisions following genotoxic stress.
22492270 findings suggest the aberrant regulation of HDAC2 and its epigenetic regulation of gene transcription in apoptosis and cell cycle components play an important role in the development of lung cancer
22416134 Data show that leucine zipper domain, not the SUMOylation of K-bZIP, is required for K-bZIP to interact with HDAC1/2 and with some KSHV lytic gene promoters and that these interactions are important for human herpesvirus-8 to replicate.
22388814 cognitive capacities in the neurodegenerating brain are constrained by an epigenetic blockade of gene transcription; this blockade is mediated by histone deacetylase 2, which is increased by Alzheimer's-disease-related neurotoxic insults
22344732 studies suggest that endometriosis etiology may be partially explained by epigenetic regulation of gene expression due to dysregulations in the expression of histone deacetylase 1 and 2
22297573 The results imply that HDAC2 is involved in the transcriptional regulation of human odontoblasts in vivo.
22156779 it has also been suggested that GRbeta can cause steroid resistance via reduced expression of histone deacetylase 2 (HDAC2), a key regulator of steroid responsiveness in the airway
22132221 The aberrant regulation of HDAC2 may play a pivotal role in the development of hepatocellular carcinoma.
22037263 HDAC1 and HDAC2 are differentially expressed in mesenchymal neoplasms
22016339 a critical regulatory mechanism of HDAC2 by Mule and suggest this pathway determines the cellular response to HDACis and DNA damage
22005560 LPS increased while trichostatin A decreased the expressions of TLR4 and HDAC2 in cultured endothelial cells.
21987499 HDAC2 is primarily located in the cell nucleus; temporal lobe epilepsy patients exhibit significantly more HDAC2 positive cells than control.
21972094 Report HDAC2 expression in histological subtypes of testicular germ cell tumours.
21957129 HDAC1 and HDAC2 differentially modulate STAT activity in response to IFNalpha2: while they are required for the induction of ISGF3-responsive genes, they impair the transcription of STAT3-dependent genes.
21725353 Studies indicate that class-I histone deacetylases (HDACs) HDAC1 and HDAC2 are direct intracellular targets of the potent sphingolipid mediator sphingosine-1-phosphate (S1P).
21685935 Data suggest a critical role of EZH2 in the control of cell invasionand/or metastasis by forming a co-repressor complex with HDAC1/HDAC2/Snail to repress E-cadherin.
21576649 A novel mechanism in the development of cardiac hypertrophy is demonstrated when transgenic casein kinase (CK)2alpha1 activates HDAC2 via phosphorylating HDAC2 serine394.
21527555 results elucidate a mechanism of p63-mediated transcriptional repression and they identify the DeltaNp63alpha/HDAC complex as an essential tumor maintenance factor in squamous cell carcinoma
21453528 HDAC3, not HDAC2, interacts with the major immediate early locus of human cytomegalovirus.
21320471 down-regulation of histone deacetylase HDAC2 causes Nrf2 instability, resulting in reduced anti-oxidant gene expression and increase sensitivity to oxidative stress.
21317427 Study conclude that DeltaNp63 is a novel target of DEC1 and HDAC2 and modulates the efficacy of HDAC inhibitors in growth suppression and keratinocyte differentiation.
21315782 results indicate upregulation of HDAC2 by Tat treatment in dose and time dependant manner by human neuroblastoma SK-N-MC cells and primary human neurons
21315782 HIV-1 Tat induces upregulation of HDAC2 expression and downregulation of CREB and CaMKIIa expression in human neuroblastoma SK-N-MC cells
21290163 Distinct protein expression patterns, affecting TXNL1 and HDAC2, distinguish aneuploid with poor prognosis from diploid colorectal cancers.
21143702 We immunohistochemically analyzed the expression of NCOR1 and 2 as well as HDAC1, 2, and 3 on a tissue microarray comprising tumor samples from 283 astrocytic gliomas
20972425 The findings reveal a novel mechanism for targeted nitrosylation of HDAC2 and suggest that protein-protein transfer of nitric oxide groups may be a general mechanism in cellular signal transduction.
20802485 identify the related human histone deacetylases HDAC1 and HDAC2 as two participants in the DNA-damage response
20731616 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20716118 Data describe the regulatory role of c-MYC over HDAC2 and PcG genes in human multipotent stem cells.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20585871 High expression of HDAC2 was associated with gastric cancer.
20534591 CAGE induced the interaction between histone deacetylase 2 (HDAC2) and Snail, which exerted a negative effect on p53 expression in neoplastic cells; CAGE confers drug resistance by regulating expression of p53 through HDAC2.
20471948 HIV-1 Tat induces upregulation of HDAC2 expression and downregulation of CREB and CaMKIIa expression in human neuroblastoma SK-N-MC cells
20467334 We found a reduction of HDAC 11 mRNA and increased HDAC 2 levels in amyotrophic lateral sclerosis brain and spinal cord compared with controls.
20421305 HDAC2 promotes eIF4E sumoylation and activates mRNA translation gene specifically
20415600 HDAC isoforms 1, 2 and 3 are highly expressed in Hodgkin's lymphoma
20398369 specific depletion of HDAC2, but not HDAC1, sensitizes Pancreatic ductal adenocarcinoma cells towards tumor necrosis factor-related apoptosis-inducing ligand (TRAIL)-induced apoptosis
20388229 The cell-autonomous function of transgenic HDAC2 exclusively in adult neurogenesis reveals clear differences in the molecular mechanisms regulating neurogenesis during development and in adulthood.
20346000 Mutations in HDAC2 exons are unlikely to play an important role in the development of corticotroph adenomas.
20346000 Observational study of gene-disease association. (HuGE Navigator)
20190809 Combination of PAD4 and HDAC2 inhibitors may be a potential strategy for cancer treatment.
20178884 Increased histone deacetylase 2 expression is involved in the acquisition of aggressive behavior by endometrial carcinoma.
20133912 Studies indicate pharmacological inhibition of protein deacetylation with histone deacetylase (HDAC) inhibitors has shown promise in preclinical models of cardiovascular and renal disease.
19935709 TGF-beta transcriptionally upregulated MMP-10 through activation of MEF2A, concomitant with acetylation of core histones increasing around the promoter, as a consequence of degradation of the class IIa HDACs.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19912635 High expression of HDAC1, HDAC2 and HDAC3 was significantly correlated with increased nuclear translocation of RelA/p65 in pancreatic cancer.
19881542 Data indicate that inhibition of claudin-1 expression by HDAC-2-specific small interfering RNA supported the role of HDAC-2 in this regulation.
19880520 activation of HIF-1alpha by hypoxia decreases HDAC2 levels, resulting in amplified inflammation and corticosteroid resistance.
19822520 Results uncovered fundamental differences between HDAC1 and HDAC2, and unveiled a new mechanism of collaborative regulation by HDAC1/2 containing coregulator complexes.
19802013 Data show that HDACs 1 and 2 are overexpressed in ATCs compared with normal cells or benign tumors.
19801684 Data show that histone deacetylase (HDAC) inhibitor, markedly suppressed HIF-1alpha transcription.
19754958 CtBP2 monomer interacts with a major CtBP-dependent repressor ZEB and HDAC and that the interaction of the two factors with the CtBP2 monomer was mutually exclusive.
19740981 hyperphosphorylated at a unique conserved Ser residue in the C terminus during varicella-zoster infection
19724929 Report efficacy of MS-275, a selective inhibitor of class I histone deacetylases, in human colon cancer models.
19706751 the ability of CBX7 to positively regulate E-cadherin expression by interacting with HDAC2 and inhibiting its activity on the E-cadherin promoter would account for the correlation between the loss of CBX7 expression and a highly malignant phenotype
19581932 HIV-1 Tat induces upregulation of HDAC2 expression and downregulation of CREB and CaMKIIa expression in human neuroblastoma SK-N-MC cells
19561124 The data indicate that the carboxy-terminal domain serves a novel function within HDAC1 and HDAC2, to mediate repression of cartilage-specific gene expression in human chondrocytes.
19531758 HDAC2 also plays an important role in cell proliferation and apoptosis of rheumatoid arthritis synovial fibroblasts
19454010 HIV-1 Tat induces upregulation of HDAC2 expression and downregulation of CREB and CaMKIIa expression in human neuroblastoma SK-N-MC cells
19446037 IL-8 and MCP-1 were differently regulated by hypoxia.
19438744 HDAC2, is overexpressed in diffuse large B-cell lymphoma and peripheral T-cell lymphoma relative to normal lymphoid tissue
19416910 deletion of a single HDAC is not sufficient to induce cell death, but HDAC1 and 2 play redundant and essential roles in tumor cell survival
19411311 Reduced HDAC2 and HDAC2 activity, but not HDAC2 mRNA, is observed in cells deficient in CFTR.
19410558 nitration of distinct tyrosine residues modifies both the expression and activity of HDAC2, having an impact on epigenetic regulation.
19383825 Reduced levels of HDAC2 was associated with breast cancer progression.
19155214 Transcription analysis and genome-wide histone modification studies on these mutants suggested that K36me2 is sufficient to target Rpd3S in vivo, thereby maintaining a functional Set2-Rpd3S pathway.
19124506 Observational study of gene-disease association. (HuGE Navigator)
19099586 findings show class I HDAC isoforms 1 and 2 are highly expressed in renal cell cancer, while HDAC 3 shows low, histology dependent expression rates
19088080 the TGFbeta pathway activation leads to recruitment of a KLF14-mSin3A-HDAC2 repressor complex to the TGFbetaRII promoter, as well as the remodeling of chromatin to increase histone marks that associate with transcriptional silencing.
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19041327 TSA treatment enhances the association of CIITA with the transcription factor RFX5, which ameliorates the down-regulation of CIITA recruitment to target promoters by HDAC2.
19015268 P/CAF deacetylation by HDAC3 and in a minor degree by HDAC1, HDAC2, or HDAC4 leads to cytoplasmic accumulation of P/CAF.
19010907 class I histone deacetylase (HDACs), specifically HDAC2, and the transcriptional repressor Snail play a central role in the suppression of 15-hydroxyprostaglandin dehydrogenase expression.
18950845 Observational study of gene-disease association. (HuGE Navigator)
18851967 In HCT116 cells, HDAC2 was shown to localize to the APAF1 promoter, and siRNA-mediated down-regulation of HDAC2 induced APAF1 expression, suggesting HDAC2 directly represses APAF1 expression.
18834886 Frequent HDAC2 mutations are found in MSI tumors and HDAC2 plays a major role in mediating apoptotic response to HDAC inhibitors through direct regulation of APAF1.
18708058 Recruitment of HDAC-1 and -2 by TNF-alpha, and a consequent deacetylation of histone H3 at the YKL-40 promoter occurs only in glioma cells.
18671804 High expression of HDAC2 is more common in aggressive than indolent cutaneous T-cell lymphoma.
18408217 LPA enhances survival of cancer cells by increasing HDAC1 and HDAC2 activity and reducing histone acetylation
18347167 Strong prognostic impact of HDAC isoforms in colorectal cancer.
18316616 depletion of HDAC2 results in simultaneous depletion of ER and PR, and potentiates the effects of antihormonal therapy in ER-positive cells
18264134 HDAC2 mutations have a role in human tumorigenesis through the derepression of key genes from multiple cellular transformation pathways
18212746 we showed that the known effects of HDACs on differentiation and proliferation of cancer cells observed in vitro can also be confirmed in vivo. The class I HDAC isoforms 1, 2 and 3 are differentially expressed in prostate cancer.
17935135 CK2 may be a key mediator for HDAC1 and HDAC2 activation under hypoxia in tumor cells
17827154 unmodified HDAC2 is associated with the coding region of transcribed genes, whereas phosphorylated HDAC2 is primarily recruited to promoters
17786334 High expression of HDAC2 is associated with cancer tissues
17322895 Transgenic HDAC2 regulates expression of many fetal cardiac isoforms, including glycogen synthase kinase 3 beta.
17043312 Brg1 and HDAC2 have roles in GR trans-repression of the pituitary POMC gene and misexpression in Cushing disease
16951198 A rationale for targeting HIF-1 alpha with histone dacetylase inhibitors against class II isozymes as anticancer agents in renal carcinoma cells.
16595694 GIOT-1-mediated transrepression was recovered by down-regulation of HDAC2 expression with small interfering RNA of HDAC2
15665816 involved in the early events of carcinogenesis, so candidate marker for tumor progression, target for cancer therapy
15456770 PELP1 recruits HDAC2 and masks histones using two separate domains
15144953 Increased HDAC2 expression is associated with colon cancer
15016876 interaction of HPV type 31 E7 with HDACs and the integrity of the zinc finger-like motifs are essential for extending the life span of keratinocytes and for stable maintenance of viral genomes
14512427 HDAC2 binds to HoxA10 and has a role in repressing gene transcription in undifferentiated myeloid cells
12972430 IkappaBalpha regulates the transcriptional activity of homeodomain-containing proteins positively through cytoplasmic sequestration of HDAC1 and HDAC3
12829790 The MLL repression domain specifically interacts with HDAC2.
12176973 HDAC2 is phosphorylated by CK2 and recruited by Sp1 or Sp3
12140263 Data show that Daxx associates with proteins critical for transcriptional repression, such as histone deacetylase 2 and Dek, a chromatin-associated protein reported to change the topology of DNA in chromatin in vitro.
12082111 Regulation by protein kinase CK2
11919195 Phosphatase inhibition leads to histone deacetylases 1 and 2 phosphorylation and disruption of corepressor interactions
9150134 mSin3A interacts with HDAC2 via the HDAC-interacting domain (HID) of mSin3A.

AA Sequence

MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHS      1 - 70
DEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGL     71 - 140
HHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTG    141 - 210
DLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVK    211 - 280
GHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSN    281 - 350
MTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEE    351 - 420
FSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP      421 - 488
//

Text Mined References (309)

PMID Year Title
26846508 2016 Histone deacetylase 2 regulates doxorubicin (Dox) sensitivity of colorectal cancer cells by targeting ABCB1 transcription.
26815200 2016 DNMT1 and HDAC2 Cooperate to Facilitate Aberrant Promoter Methylation in Inorganic Phosphate-Induced Endothelial-Mesenchymal Transition.
26683361 2016 The role of HDAC2 in chromatin remodelling and response to chemotherapy in ovarian cancer.
26617781 2015 USP17-mediated deubiquitination and stabilization of HDAC2 in cigarette smoke extract-induced inflammation.
26502922 2015 Histone deacetylase (HDAC)-1, -2, -4 and -6 expression in human pancreatic adenocarcinoma: associations with clinicopathological parameters, tumor proliferative capacity and patients' survival.
26498345 2015 Lymphocyte senescence in COPD is associated with decreased histone deacetylase 2 expression by pro-inflammatory lymphocytes.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26359372 2015 Aberrant expression and activity of histone deacetylases in sporadic idiopathic pulmonary fibrosis.
26255936 2015 Damaged DNA-binding protein down-regulates epigenetic mark H3K56Ac through histone deacetylase 1 and 2.
26116233 2015 Histone hypoacetylation and increased histone deacetylases in peripheral blood mononuclear cells from patients with Graves' disease.
26063464 2015 Genetic analysis of common variants in the HDAC2 gene with schizophrenia susceptibility in Han Chinese.
26028330 2015 Dysfunction of the Reciprocal Feedback Loop between GATA3- and ZEB2-Nucleated Repression Programs Contributes to Breast Cancer Metastasis.
25942572 2015 Histone deacetylases 1 and 2 regulate DNA replication and DNA repair: potential targets for genome stability-mechanism-based therapeutics for a subset of cancers.
25808664 2015 Inactivation of HDAC1 or HDAC2 induces gamma globin expression without altering cell cycle or proliferation.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25704882 2015 Sumoylation of HDAC2 promotes NF-?B-dependent gene expression.
25697359 2015 p15RS/RPRD1A (p15INK4b-related sequence/regulation of nuclear pre-mRNA domain-containing protein 1A) interacts with HDAC2 in inhibition of the Wnt/?-catenin signaling pathway.
25688158 2015 Selective Inhibition of HDAC1 and HDAC2 as a Potential Therapeutic Option for B-ALL.
25655932 2015 NEDDylation promotes endothelial dysfunction: a role for HDAC2.
25605253 2015 Selective inhibition of histone deacetylase 2 induces p53-dependent survivin downregulation through MDM2 proteasomal degradation.
25523932 2014 Histone acetyltransferase inhibitor II induces apoptosis in glioma cell lines via the p53 signaling pathway.
25492968 2014 Histone deacetylases in memory and cognition.
25486475 2014 BRG1, the ATPase subunit of SWI/SNF chromatin remodeling complex, interacts with HDAC2 to modulate telomerase expression in human cancer cells.
25473896 2015 HDAC2 deregulation in tumorigenesis is causally connected to repression of immune modulation and defense escape.
25314079 2014 Acetylation of snail modulates the cytokinome of cancer cells to enhance the recruitment of macrophages.
25270209 2014 [Regulatory effect of ginsenoside Rh2 on HDAC1/2 activity and cyclin in human erythroleukemia K562 cells].
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25136952 2014 Selective HDAC inhibition for the disruption of latent HIV-1 infection.
25013374 2014 Cyclic phosphatidic acid inhibits alkyl-glycerophosphate-induced downregulation of histone deacetylase 2 expression and suppresses the inflammatory response in human coronary artery endothelial cells.
24970816 2014 The subcellular distribution and function of MTA1 in cancer differentiation.
24965412 Effect of downregulated histone deacetylase 2 expression on cell proliferation and cell cycle in cervical cancer.
24958469 2014 Antitumor effects in hepatocarcinoma of isoform-selective inhibition of HDAC2.
24939842 2014 Histone cross-talk connects protein phosphatase 1? (PP1?) and histone deacetylase (HDAC) pathways to regulate the functional transition of bromodomain-containing 4 (BRD4) for inducible gene expression.
24833798 2014 Transcriptional regulation of endothelial arginase 2 by histone deacetylase 2.
24788349 2014 Melittin restores PTEN expression by down-regulating HDAC2 in human hepatocelluar carcinoma HepG2 cells.
24763403 2014 Sin3a-associated Hdac1 and Hdac2 are essential for hematopoietic stem cell homeostasis and contribute differentially to hematopoiesis.
24616922 2014 Oncogenic potential of CK2? and its regulatory role in EGF-induced HDAC2 expression in human liver cancer.
24448241 2014 HDAC2 provides a critical support to malignant progression of hepatocellular carcinoma through feedback control of mTORC1 and AKT.
24390319 2014 VPA inhibits renal cancer cell migration by targeting HDAC2 and down-regulating HIF-1?.
24376786 2013 Nuclear localization of the transcriptional regulator MIER1? requires interaction with HDAC1/2 in breast cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24239178 2014 Holocarboxylase synthetase acts as a biotin-independent transcriptional repressor interacting with HDAC1, HDAC2 and HDAC7.
24218540 2014 Chemopreventive effects of an HDAC2-selective inhibitor on rat colon carcinogenesis and APCmin/+ mouse intestinal tumorigenesis.
24105979 2014 Histone deacetylase inhibition with valproic acid downregulates osteocalcin gene expression in human dental pulp stem cells and osteoblasts: evidence for HDAC2 involvement.
24030221 2014 Passive smoking impairs histone deacetylase-2 in children with severe asthma.
23975430 2014 Significance of PELP1/HDAC2/miR-200 regulatory network in EMT and metastasis of breast cancer.
23939379 2013 Histone deacetylase regulation of ATM-mediated DNA damage signaling.
23926105 2013 Loss of epigenetic Kruppel-like factor 4 histone deacetylase (KLF-4-HDAC)-mediated transcriptional suppression is crucial in increasing vascular endothelial growth factor (VEGF) expression in breast cancer.
23891737 2013 Aberrant histone modification in peripheral blood B cells from patients with systemic sclerosis.
23857786 2013 Associations of histone deacetylase-2 and histone deacetylase-3 genes with schizophrenia in a Chinese population.
23831020 2013 Repression of NR4A1 by a chromatin modifier promotes docetaxel resistance in PC-3 human prostate cancer cells.
23752268 2013 The functional interactome landscape of the human histone deacetylase family.
23717666 2013 Changes in airway histone deacetylase2 in smokers and COPD with inhaled corticosteroids: a randomized controlled trial.
23714156 2013 Gender matters: estrogen receptor alpha (ER?) and histone deacetylase (HDAC) 1 and 2 control the gender-specific transcriptional regulation of human uridine diphosphate glucuronosyltransferases genes (UGT1A).
23615070 Polymorphisms in histone deacetylases improve the predictive value of IL-28B for chronic hepatitis C therapy.
23612983 2013 Protein kinase CK2 regulates the dimerization of histone deacetylase 1 (HDAC1) and HDAC2 during mitosis.
23554474 2013 Histone deacetylase 2 cell autonomously suppresses excitatory and enhances inhibitory synaptic function in CA1 pyramidal neurons.
23544610 2013 HDAC inhibitor trichostatin A suppresses esophageal squamous cell carcinoma metastasis through HADC2 reduced MMP-2/9.
23499894 2013 MiR-145 functions as a tumor suppressor by directly targeting histone deacetylase 2 in liver cancer.
23440245 2013 A dual role for Hdac1: oncosuppressor in tumorigenesis, oncogene in tumor maintenance.
23280436 2013 Dynamic distribution of HDAC1 and HDAC2 during mitosis: association with F-actin.
23275209 2013 Expression level of histone deacetylase 2 correlates with occurring of chronic obstructive pulmonary diseases.
23251689 2012 Class I and class II histone deacetylases are potential therapeutic targets for treating pancreatic cancer.
23242568 2013 Overexpression of histone deacetylase 2 predicts unfavorable prognosis in human gallbladder carcinoma.
23195070 2013 Regulation of intestinal serotonin transporter expression via epigenetic mechanisms: role of HDAC2.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23175521 2013 Targeted inactivation of HDAC2 restores p16INK4a activity and exerts antitumor effects on human gastric cancer.
23110995 2012 X-radiation inhibits histone deacetylase 1 and 2, upregulates Axin expression and induces apoptosis in non-small cell lung cancer.
22944197 2013 Changes in histone deacetylase (HDAC) expression patterns and activity of HDAC inhibitors in urothelial cancers.
22932458 2012 [Effect of down-regulation of histone deacetylase 2 protein expression on cell proliferation and cell cycle in cervical carcinoma].
22932408 2012 [Down-regulation of histone deacetylase 2 induces cell apoptosis and inhibits cell proliferation and migration of laryngeal squamous cell carcinoma cells].
22926524 2013 RBB, a novel transcription repressor, represses the transcription of HDM2 oncogene.
22798432 2012 Glucocorticoid receptor and histone deacetylase-2 mediate dexamethasone-induced repression of MUC5AC gene expression.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22641068 2012 Histone deacetylases activate hepatocyte growth factor signaling by repressing microRNA-449 in hepatocellular carcinoma cells.
22493095 2012 Dynamically regulated sumoylation of HDAC2 controls p53 deacetylation and restricts apoptosis following genotoxic stress.
22492270 2012 HDAC2 overexpression confers oncogenic potential to human lung cancer cells by deregulating expression of apoptosis and cell cycle proteins.
22416134 2012 Leucine zipper domain is required for Kaposi sarcoma-associated herpesvirus (KSHV) K-bZIP protein to interact with histone deacetylase and is important for KSHV replication.
22388814 2012 An epigenetic blockade of cognitive functions in the neurodegenerating brain.
22344732 2012 HDAC1 and HDAC2 are differentially expressed in endometriosis.
22297573 2012 Histone deacetylases 2 and 9 are coexpressed and nuclear localized in human molar odontoblasts in vivo.
22156779 2012 Glucocorticoid receptor ? and histone deacetylase 1 and 2 expression in the airways of severe asthma.
22132221 2011 Aberrant regulation of HDAC2 mediates proliferation of hepatocellular carcinoma cells by deregulating expression of G1/S cell cycle proteins.
22037263 2012 Histone deacetylase 1 and 2 in mesenchymal tumors.
22016339 2011 Mule determines the apoptotic response to HDAC inhibitors by targeted ubiquitination and destruction of HDAC2.
22005560 2011 [The effects of a histone deacetylase (HDAC) inhibitor on endotoxin-induced endothelial cell injury].
21987499 2012 Increased expression of histone deacetylases 2 in temporal lobe epilepsy: a study of epileptic patients and rat models.
21972094 2011 Expression of histone deacetylases 1, 2 and 3 in histological subtypes of testicular germ cell tumours.
21965678 2011 SUMOylation and SUMO-interacting motif (SIM) of metastasis tumor antigen 1 (MTA1) synergistically regulate its transcriptional repressor function.
21957129 2012 Opposed regulation of type I IFN-induced STAT3 and ISGF3 transcriptional activities by histone deacetylases (HDACS) 1 and 2.
21914818 2011 A BEN-domain-containing protein associates with heterochromatin and represses transcription.
21725353 2012 Endogenous modulators and pharmacological inhibitors of histone deacetylases in cancer therapy.
21685935 2012 EZH2 supports nasopharyngeal carcinoma cell aggressiveness by forming a co-repressor complex with HDAC1/HDAC2 and Snail to inhibit E-cadherin.
21576649 2011 Casein kinase-2?1 induces hypertrophic response by phosphorylation of histone deacetylase 2 S394 and its activation in the heart.
21573134 2011 Nuclear cGMP-dependent kinase regulates gene expression via activity-dependent recruitment of a conserved histone deacetylase complex.
21549307 2011 Maintenance of silent chromatin through replication requires SWI/SNF-like chromatin remodeler SMARCAD1.
21527555 2011 Physical association of HDAC1 and HDAC2 with p63 mediates transcriptional repression and tumor maintenance in squamous cell carcinoma.
21453528 2011 Histone deacetylase 3, not histone deacetylase 2, interacts with the major immediate early locus of human cytomegalovirus.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21320471 2011 Decreased histone deacetylase 2 impairs Nrf2 activation by oxidative stress.
21317427 2011 DeltaNp63, a target of DEC1 and histone deacetylase 2, modulates the efficacy of histone deacetylase inhibitors in growth suppression and keratinocyte differentiation.
21315782 2011 HIV-1 Tat upregulates expression of histone deacetylase-2 (HDAC2) in human neurons: implication for HIV-associated neurocognitive disorder (HAND).
21290163 2011 HDAC2 and TXNL1 distinguish aneuploid from diploid colorectal cancers.
21269460 2011 Initial characterization of the human central proteome.
21258344 2011 Chemoproteomics profiling of HDAC inhibitors reveals selective targeting of HDAC complexes.
21143702 2011 Expression of nuclear receptor corepressors and class I histone deacetylases in astrocytic gliomas.
21093383 2010 Hdac1 and Hdac2 act redundantly to control p63 and p53 functions in epidermal progenitor cells.
20972425 2010 GAPDH mediates nitrosylation of nuclear proteins.
20802485 2010 Human HDAC1 and HDAC2 function in the DNA-damage response to promote DNA nonhomologous end-joining.
20731616 2010 Combination of polymorphisms within the HDAC1 and HDAC3 gene predict tumor recurrence in hepatocellular carcinoma patients that have undergone transplant therapy.
20716118 2011 The regulatory role of c-MYC on HDAC2 and PcG expression in human multipotent stem cells.
20651739 2010 Acetylation-dependent oncogenic activity of metastasis-associated protein 1 co-regulator.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20585871 2010 Histone deacetylase (HDAC) 1 and 2 expression and chemotherapy in gastric cancer.
20534591 2010 Cancer/testis antigen CAGE exerts negative regulation on p53 expression through HDAC2 and confers resistance to anti-cancer drugs.
20467334 2010 Differential histone deacetylase mRNA expression patterns in amyotrophic lateral sclerosis.
20421305 2010 HDAC2 promotes eIF4E sumoylation and activates mRNA translation gene specifically.
20415600 2010 Class I histone deacetylases 1, 2 and 3 are highly expressed in classical Hodgkin's lymphoma.
20398657 2010 The steroid receptor RNA activator protein is recruited to promoter regions and acts as a transcriptional repressor.
20398369 2010 HDAC2 attenuates TRAIL-induced apoptosis of pancreatic cancer cells.
20392638 2010 Exploration of the HDAC2 foot pocket: Synthesis and SAR of substituted N-(2-aminophenyl)benzamides.
20388229 2010 The specific role of histone deacetylase 2 in adult neurogenesis.
20346000 2010 HDAC2 expression and variable number of repeats in exon 1 of the HDAC2 gene in corticotroph adenomas.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
20190809 2010 Coordination of PAD4 and HDAC2 in the regulation of p53-target gene expression.
20178884 2010 Immunohistochemical detection of histone deacetylases in endometrial carcinoma: involvement of histone deacetylase 2 in the proliferation of endometrial carcinoma cells.
20133912 2010 Protein acetylation in the cardiorenal axis: the promise of histone deacetylase inhibitors.
20075857 2010 JARID2 regulates binding of the Polycomb repressive complex 2 to target genes in ES cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19935709 2010 Transcriptional induction of MMP-10 by TGF-beta, mediated by activation of MEF2A and downregulation of class IIa HDACs.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19912635 2009 High class I HDAC activity and expression are associated with RelA/p65 activation in pancreatic cancer in vitro and in vivo.
19881542 2010 HDAC inhibitors regulate claudin-1 expression in colon cancer cells through modulation of mRNA stability.
19880520 2009 Hypoxia-inducible factor 1alpha induces corticosteroid-insensitive inflammation via reduction of histone deacetylase-2 transcription.
19822520 2009 Trans-regulation of histone deacetylase activities through acetylation.
19805145 2009 E3 ubiquitin ligase COP1 regulates the stability and functions of MTA1.
19802013 2010 Histone deacetylase inhibitors induce thyroid cancer-specific apoptosis through proteasome-dependent inhibition of TRAIL degradation.
19801684 2009 Reactive oxygen species-generating mitochondrial DNA mutation up-regulates hypoxia-inducible factor-1alpha gene transcription via phosphatidylinositol 3-kinase-Akt/protein kinase C/histone deacetylase pathway.
19754958 2009 Interaction of ZEB and histone deacetylase with the PLDLS-binding cleft region of monomeric C-terminal binding protein 2.
19740981 2009 Histone deacetylases 1 and 2 are phosphorylated at novel sites during varicella-zoster virus infection.
19724929 2009 Efficacy of MS-275, a selective inhibitor of class I histone deacetylases, in human colon cancer models.
19706751 2009 Chromobox protein homologue 7 protein, with decreased expression in human carcinomas, positively regulates E-cadherin expression by interacting with the histone deacetylase 2 protein.
19703393 2009 LSD1 is a subunit of the NuRD complex and targets the metastasis programs in breast cancer.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19644445 2009 ZIP: a novel transcription repressor, represses EGFR oncogene and suppresses breast carcinogenesis.
19561124 2009 A novel domain in histone deacetylase 1 and 2 mediates repression of cartilage-specific genes in human chondrocytes.
19531758 2009 Expression and function of histone deacetylases in rheumatoid arthritis synovial fibroblasts.
19505873 2009 Complementary quantitative proteomics reveals that transcription factor AP-4 mediates E-box-dependent complex formation for transcriptional repression of HDM2.
19497860 2009 LSD1-mediated epigenetic modification is required for TAL1 function and hematopoiesis.
19446037 2009 Regulation of chemokine gene expression by hypoxia via cooperative activation of NF-kappaB and histone deacetylase.
19438744 2009 Histone deacetylase 1, 2, 6 and acetylated histone H4 in B- and T-cell lymphomas.
19416910 2009 Genetic dissection of histone deacetylase requirement in tumor cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19411311 2009 Loss of CFTR results in reduction of histone deacetylase 2 in airway epithelial cells.
19410558 2009 Nitration of distinct tyrosine residues causes inactivation of histone deacetylase 2.
19383825 2009 Protein acetylation and histone deacetylase expression associated with malignant breast cancer progression.
19372552 2009 HDAC2 regulates chromatin plasticity and enhances DNA vulnerability.
19343227 2009 FE65 binds Teashirt, inhibiting expression of the primate-specific caspase-4.
19276356 2009 FOXP3 up-regulates p21 expression by site-specific inhibition of histone deacetylase 2/histone deacetylase 4 association to the locus.
19182791 2009 Chfr is linked to tumour metastasis through the downregulation of HDAC1.
19155214 2009 Histone H3 lysine 36 dimethylation (H3K36me2) is sufficient to recruit the Rpd3s histone deacetylase complex and to repress spurious transcription.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
19099586 2008 Class I histone deacetylases 1, 2 and 3 are highly expressed in renal cell cancer.
19088080 2009 Silencing of the transforming growth factor-beta (TGFbeta) receptor II by Kruppel-like factor 14 underscores the importance of a negative feedback mechanism in TGFbeta signaling.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
19061646 2008 CDYL bridges REST and histone methyltransferases for gene repression and suppression of cellular transformation.
19041327 2009 HDAC2 deacetylates class II transactivator and suppresses its activity in macrophages and smooth muscle cells.
19015268 2009 Autoacetylation regulates P/CAF nuclear localization.
19010907 2008 Repression of 15-hydroxyprostaglandin dehydrogenase involves histone deacetylase 2 and snail in colorectal cancer.
18950845 2009 Evaluating new candidate SNPs as low penetrance risk factors in sporadic breast cancer: a two-stage Spanish case-control study.
18851967 2008 Making sense of HDAC2 mutations in colon cancer.
18834886 2008 An inactivating mutation in HDAC2 leads to dysregulation of apoptosis mediated by APAF1.
18757745 2008 RCS1, a substrate of APC/C, controls the metaphase to anaphase transition.
18754010 2008 S-Nitrosylation of histone deacetylase 2 induces chromatin remodelling in neurons.
18708058 2008 Selective repression of YKL-40 by NF-kappaB in glioma cell lines involves recruitment of histone deacetylase-1 and -2.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18671804 2008 Prognostic significance of the therapeutic targets histone deacetylase 1, 2, 6 and acetylated histone H4 in cutaneous T-cell lymphoma.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18451879 2008 Atrophin recruits HDAC1/2 and G9a to modify histone H3K9 and to determine cell fates.
18408217 2008 Lysophosphatidic acid protects cancer cells from histone deacetylase (HDAC) inhibitor-induced apoptosis through activation of HDAC.
18347167 2008 Class I histone deacetylase expression has independent prognostic impact in human colorectal cancer: specific role of class I histone deacetylases in vitro and in vivo.
18316616 2008 Selective inhibition of histone deacetylase 2 silences progesterone receptor-mediated signaling.
18264134 2008 Transforming pathways unleashed by a HDAC2 mutation in human cancer.
18212746 2008 Histone deacetylases 1, 2 and 3 are highly expressed in prostate cancer and HDAC2 expression is associated with shorter PSA relapse time after radical prostatectomy.
18212045 2008 CtBP is an essential corepressor for BCL6 autoregulation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17984088 2008 Dual role of NRSF/REST in activation and repression of the glucocorticoid response.
17935135 2008 Protein kinase CK2 is a key activator of histone deacetylase in hypoxia-associated tumors.
17827154 2007 Differential distribution of unmodified and phosphorylated histone deacetylase 2 in chromatin.
17786334 2007 Expression profile of class I histone deacetylases in human cancer tissues.
17785205 2007 LZAP, a putative tumor suppressor, selectively inhibits NF-kappaB.
17322895 2007 Hdac2 regulates the cardiac hypertrophic response by modulating Gsk3 beta activity.
17318229 2007 Nucleophosmin acts as a novel AP2alpha-binding transcriptional corepressor during cell differentiation.
17314511 2007 Large-scale identification of c-MYC-associated proteins using a combined TAP/MudPIT approach.
17245431 2007 Recruitment of chromatin-modifying enzymes by CTIP2 promotes HIV-1 transcriptional silencing.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17043312 2006 Role of Brg1 and HDAC2 in GR trans-repression of the pituitary POMC gene and misexpression in Cushing disease.
16951198 2006 Class II histone deacetylases are associated with VHL-independent regulation of hypoxia-inducible factor 1 alpha.
16919237 2006 Breast cancer metastasis suppressor 1 (BRMS1) is stabilized by the Hsp90 chaperone.
16820529 2006 SAP30L interacts with members of the Sin3A corepressor complex and targets Sin3A to the nucleolus.
16642021 2006 A truncating mutation of HDAC2 in human cancers confers resistance to histone deacetylase inhibition.
16595694 2006 Orphan nuclear receptor Nur77 induces zinc finger protein GIOT-1 gene expression, and GIOT-1 acts as a novel corepressor of orphan nuclear receptor SF-1 via recruitment of HDAC2.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16464847 2006 Regulatory factor for X-box family proteins differentially interact with histone deacetylases to repress collagen alpha2(I) gene (COL1A2) expression.
16254079 2005 The ErbB3 binding protein Ebp1 interacts with Sin3A to repress E2F1 and AR-mediated transcription.
16217013 2005 Heterogeneous nuclear ribonucleoprotein C1/C2, MeCP1, and SWI/SNF form a chromatin remodeling complex at the beta-globin locus control region.
15927959 2005 Functional characterization of JMJD2A, a histone deacetylase- and retinoblastoma-binding protein.
15775975 2005 Cell cycle regulation of chromatin at an origin of DNA replication.
15665816 2005 Inhibition of histone deacetylase 2 increases apoptosis and p21Cip1/WAF1 expression, independent of histone deacetylase 1.
15653507 2005 Stat3 dimerization regulated by reversible acetylation of a single lysine residue.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15456770 2004 The transcriptional corepressor, PELP1, recruits HDAC2 and masks histones using two separate domains.
15456747 2004 MBD3L1 is a transcriptional repressor that interacts with methyl-CpG-binding protein 2 (MBD2) and components of the NuRD complex.
15451426 2004 Identification of a novel BRMS1-homologue protein p40 as a component of the mSin3A/p33(ING1b)/HDAC1 deacetylase complex.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15325272 2004 Characterization of BHC80 in BRAF-HDAC complex, involved in neuron-specific gene repression.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15144953 2004 Induction of HDAC2 expression upon loss of APC in colorectal tumorigenesis.
15138260 2004 Transforming growth factor-beta stimulates p300-dependent RUNX3 acetylation, which inhibits ubiquitination-mediated degradation.
15120635 2004 DNMT3B interacts with hSNF2H chromatin remodeling enzyme, HDACs 1 and 2, and components of the histone methylation system.
15060175 2004 Multiple domains of the Receptor-Interacting Protein 140 contribute to transcription inhibition.
15016876 2004 The binding of histone deacetylases and the integrity of zinc finger-like motifs of the E7 protein are essential for the life cycle of human papillomavirus type 31.
14966270 2004 Structural and functional conservation of the NuA4 histone acetyltransferase complex from yeast to humans.
14752048 2004 Modification of de novo DNA methyltransferase 3a (Dnmt3a) by SUMO-1 modulates its interaction with histone deacetylases (HDACs) and its capacity to repress transcription.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14633989 2003 Role of acetylated human AP-endonuclease (APE1/Ref-1) in regulation of the parathyroid hormone gene.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
14512427 2003 HoxA10 represses gene transcription in undifferentiated myeloid cells by interaction with histone deacetylase 2.
12975471 2003 Cardiac hypertrophy and histone deacetylase-dependent transcriptional repression mediated by the atypical homeodomain protein Hop.
12972430 2003 Cytoplasmic IkappaBalpha increases NF-kappaB-independent transcription through binding to histone deacetylase (HDAC) 1 and HDAC3.
12947414 2003 Cdyl: a new transcriptional co-repressor.
12943729 2003 Dual mechanisms of regulation of transcription of luteinizing hormone receptor gene by nuclear orphan receptors and histone deacetylase complexes.
12920132 2003 The metastasis-associated proteins 1 and 2 form distinct protein complexes with histone deacetylase activity.
12829790 2003 MLL repression domain interacts with histone deacetylases, the polycomb group proteins HPC2 and BMI-1, and the corepressor C-terminal-binding protein.
12788942 2003 The protein phosphatase-1 (PP1) regulator, nuclear inhibitor of PP1 (NIPP1), interacts with the polycomb group protein, embryonic ectoderm development (EED), and functions as a transcriptional repressor.
12724404 2003 Identification and characterization of three new components of the mSin3A corepressor complex.
12711603 2003 Methyl-CpG binding domain 1 (MBD1) interacts with the Suv39h1-HP1 heterochromatic complex for DNA methylation-based transcriptional repression.
12711221 2003 Class II histone deacetylases: versatile regulators.
12705869 2003 MTA3, a Mi-2/NuRD complex subunit, regulates an invasive growth pathway in breast cancer.
12682367 2003 Repression of E2F1-mediated transcription by the ErbB3 binding protein Ebp1 involves histone deacetylases.
12670868 2003 Human Sin3 deacetylase and trithorax-related Set1/Ash2 histone H3-K4 methyltransferase are tethered together selectively by the cell-proliferation factor HCF-1.
12634383 2003 Epstein-Barr virus nuclear antigen 3C recruits histone deacetylase activity and associates with the corepressors mSin3A and NCoR in human B-cell lines.
12586827 2003 A novel EID-1 family member, EID-2, associates with histone deacetylases and inhibits muscle differentiation.
12493763 2003 A candidate X-linked mental retardation gene is a component of a new family of histone deacetylase-containing complexes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12419806 2003 Post-activation turn-off of NF-kappa B-dependent transcription is regulated by acetylation of p65.
12402037 2002 Acetylation inactivates the transcriptional repressor BCL6.
12398767 2003 An ERG (ets-related gene)-associated histone methyltransferase interacts with histone deacetylases 1/2 and transcription co-repressors mSin3A/B.
12371150 2002 Control of the cell cycle by neurotrophins: lessons from the p75 neurotrophin receptor.
12198164 2002 TIS7 interacts with the mammalian SIN3 histone deacetylase complex in epithelial cells.
12176973 2002 The transcriptional repressor Sp3 is associated with CK2-phosphorylated histone deacetylase 2.
12151407 2002 Sp1 and Sp3 recruit histone deacetylase to repress transcription of human telomerase reverse transcriptase (hTERT) promoter in normal human somatic cells.
12140263 2002 Daxx and histone deacetylase II associate with chromatin through an interaction with core histones and the chromatin-associated protein Dek.
12138131 2002 Histone deacetylases augment cytokine induction of the iNOS gene.
12124384 2002 The mCpG-binding domain of human MBD3 does not bind to mCpG but interacts with NuRD/Mi2 components HDAC1 and MTA2.
12091390 2002 Silencing of transcription of the human luteinizing hormone receptor gene by histone deacetylase-mSin3A complex.
12082111 2002 Regulation of histone deacetylase 2 by protein kinase CK2.
12032298 2002 A core-BRAF35 complex containing histone deacetylase mediates repression of neuronal-specific genes.
12015313 2002 A molecular dissection of the repression circuitry of Ikaros.
12007404 2002 An induced Ets repressor complex regulates growth arrest during terminal macrophage differentiation.
11923873 2002 Bop encodes a muscle-restricted protein containing MYND and SET domains and is essential for cardiac differentiation and morphogenesis.
11919195 2002 Phosphatase inhibition leads to histone deacetylases 1 and 2 phosphorylation and disruption of corepressor interactions.
11867749 2002 The peroxisome proliferator-activated receptor delta, an integrator of transcriptional repression and nuclear receptor signaling.
11836251 2002 Murine Sall1 represses transcription by recruiting a histone deacetylase complex.
11788710 2002 Functional and physical interaction between the histone methyl transferase Suv39H1 and histone deacetylases.
11779848 2002 Functional domains of histone deacetylase-3.
11739383 2002 Isolation and characterization of a novel class II histone deacetylase, HDAC10.
11641274 2001 FIH-1: a novel protein that interacts with HIF-1alpha and VHL to mediate repression of HIF-1 transcriptional activity.
11533236 2001 ETO, a target of t(8;21) in acute leukemia, makes distinct contacts with multiple histone deacetylases and binds mSin3A through its oligomerization domain.
11532945 2001 The FK506-binding protein 25 functionally associates with histone deacetylases and with transcription factor YY1.
11486036 2001 Regulation of transcription factor YY1 by acetylation and deacetylation.
11331609 2001 Sharp, an inducible cofactor that integrates nuclear receptor repression and activation.
11302704 2001 Homo-oligomerisation and nuclear localisation of mouse histone deacetylase 1.
11287668 2001 HDA2 and HDA3 are related proteins that interact with and are essential for the activity of the yeast histone deacetylase HDA1.
11259576 2001 The growth suppressor PML represses transcription by functionally and physically interacting with histone deacetylases.
11171972 2001 CoREST is an integral component of the CoREST- human histone deacetylase complex.
11146623 2001 Transcriptional repression of oestrogen receptor by metastasis-associated protein 1 corepressor.
11102443 2001 Stable histone deacetylase complexes distinguished by the presence of SANT domain proteins CoREST/kiaa0071 and Mta-L1.
11062478 2000 Histone deacetylase interacts directly with DNA topoisomerase II.
11022042 2001 Association of COOH-terminal-binding protein (CtBP) and MEF2-interacting transcription repressor (MITR) contributes to transcriptional repression of the MEF2 transcription factor.
11013263 2000 A novel nuclear receptor corepressor complex, N-CoR, contains components of the mammalian SWI/SNF complex and the corepressor KAP-1.
10933397 2000 Cabin1 represses MEF2-dependent Nur77 expression and T cell apoptosis by controlling association of histone deacetylases and acetylases with MEF2.
10904264 2000 NuRD and SIN3 histone deacetylase complexes in development.
10888872 2000 DNMT1 binds HDAC2 and a new co-repressor, DMAP1, to form a complex at replication foci.
10766745 2000 Ikaros interactions with CtBP reveal a repression mechanism that is independent of histone deacetylase activity.
10669754 2000 Sequestration and inhibition of Daxx-mediated transcriptional repression by PML.
10644367 2000 A role for SKIP in EBNA2 activation of CBF1-repressed promoters.
10581039 1999 Transcriptional repression mediated by the human polycomb-group protein EED involves histone deacetylation.
10545197 1999 Molecular association between ATR and two components of the nucleosome remodeling and deacetylating complex, HDAC2 and CHD4.
10508171 1999 Ligand-induced recruitment of a histone deacetylase in the negative-feedback regulation of the thyrotropin beta gene.
10490602 1999 RBP1 recruits both histone deacetylase-dependent and -independent repression activities to retinoblastoma family proteins.
10471500 1999 Mi-2 complex couples DNA methylation to chromatin remodelling and histone deacetylation.
10471499 1999 MBD2 is a transcriptional repressor belonging to the MeCP1 histone deacetylase complex.
10444591 1999 Analysis of the NuRD subunits reveals a histone deacetylase core complex and a connection with DNA methylation.
10357820 1999 Repression by Ikaros and Aiolos is mediated through histone deacetylase complexes.
10220405 1999 BRCA1 interacts with components of the histone deacetylase complex.
9874765 1999 CIR, a corepressor linking the DNA binding factor CBF1 to the histone deacetylase complex.
9804427 1998 Chromatin deacetylation by an ATP-dependent nucleosome remodelling complex.
9790534 1998 The dermatomyositis-specific autoantigen Mi2 is a component of a complex containing histone deacetylase and nucleosome remodeling activities.
9782097 1998 Human histone deacetylase 2, HDAC2 (Human RPD3), is localized to 6q21 by radiation hybrid mapping.
9722949 1998 Identification and mapping of human histone acetylation modifier gene homologues.
9520398 1998 A role for histone deacetylase activity in HDAC1-mediated transcriptional repression.
9346952 1997 Isolation and characterization of cDNAs corresponding to an additional member of the human histone deacetylase gene family.
9150135 1997 Histone deacetylases and SAP18, a novel polypeptide, are components of a human Sin3 complex.
9150134 1997 Histone deacetylases associated with the mSin3 corepressor mediate mad transcriptional repression.
8917507 1996 Transcriptional repression by YY1 is mediated by interaction with a mammalian homolog of the yeast global regulator RPD3.