Property Summary

Ligand Count 122
NCBI Gene PubMed Count 26
PubMed Score 181.52
PubTator Score 45.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.700 7.6e-05
Astrocytoma, Pilocytic -1.200 4.4e-05
atypical teratoid / rhabdoid tumor -2.000 1.1e-09
ependymoma -1.400 3.9e-02
glioblastoma -1.400 1.8e-06
group 3 medulloblastoma -1.200 3.3e-03
malignant mesothelioma -1.200 4.2e-06
medulloblastoma, large-cell -2.800 1.7e-06
osteosarcoma 1.471 1.1e-06
primitive neuroectodermal tumor -1.500 7.8e-04

Gene RIF (11)

AA Sequence

MLHTTQLYQHVPETRWPIVYSPRYNITFMGLEKLHPFDAGKWGKVINFLKEEKLLSDSMLVEAREASEED      1 - 70
LLVVHTRRYLNELKWSFAVATITEIPPVIFLPNFLVQRKVLRPLRTQTGGTIMAGKLAVERGWAINVGGG     71 - 140
FHHCSSDRGGGFCAYADITLAIKFLFERVEGISRATIIDLDAHQGNGHERDFMDDKRVYIMDVYNRHIYP    141 - 210
GDRFAKQAIRRKVELEWGTEDDEYLDKVERNIKKSLQEHLPDVVVYNAGTDILEGDRLGGLSISPAGIVK    211 - 280
RDELVFRMVRGRRVPILMVTSGGYQKRTARIIADSILNLFGLGLIGPESPSVSAQNSDTPLLPPAVP       281 - 347
//

Text Mined References (28)

PMID Year Title