Property Summary

Ligand Count 186
NCBI Gene PubMed Count 26
PubMed Score 44.14
PubTator Score 31.37

Knowledge Summary


No data available


  Disease (3)


  Differential Expression (1)

Disease log2 FC p
breast carcinoma 1.300 2.3e-02

Protein-protein Interaction (11)

Gene RIF (17)

AA Sequence

PSLGPSSVASPEDVQALMYLRGQLEPQWKMLQCHPHLVA                                   631 - 669

Text Mined References (28)

PMID Year Title