Property Summary

NCBI Gene PubMed Count 26
PubMed Score 40.70
PubTator Score 31.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (1)

Disease log2 FC p
breast carcinoma 1.300 2.3e-02

Protein-protein Interaction (12)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
651910 confirmatory 0 / 0 / 1 ML327 E-Cadherin HDAC Spectrum Assay_HDAC10

Gene RIF (17)

PMID Text
26240284 HDAC10 regulates cyclin A2 expression by deacetylating histones near the let-7 promoter.
26221039 study identifies an HDAC10-mediated regulatory mechanism controlling the DNA mismatch repair function of MSH2.
25337229 Suggest HDAC10 expression as a prognostic marker for gastric cancer.
24145760 this study is describing HDAC10 as a promoter of autophagy-mediated survival in neuroblastoma cells and identifying this HDAC isozyme as a druggable regulator of advanced-stage tumor cell survival.
23897811 HDAC10 suppresses expression of matrix metalloproteinase (MMP) 2 and 9 genes, which are known to be critical for cancer cell invasion and metastasis
23801752 results demonstrate that HDAC10 protects cancer cells from cytotoxic agents by mediating autophagy and identify this HDAC isozyme as a druggable regulator of advanced-stage tumor cell survival
21247901 Histone deacetylases 9 and 10 are required for homologous recombination.
20680488 HDAC10 is involved in transcriptional downregulation of TXNIP, leading to altered reactive oxygen species signaling in human gastric cancer cells.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20471694 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20032463 Results not only show that HDAC10 regulates melanogenesis but also demonstrate that the transcriptional activities of Pax3 and KAP1 are intimately linked to their acetylation status.
19913121 Observational study of gene-disease association. (HuGE Navigator)
17892858 Observational study of gene-disease association. (HuGE Navigator)
17892858 Results suggest that the "T" allele of HDAC10-589C>T affect on the increased transcription activity, and might accelerate HCC development through increased expression of HDAC10.
15305372 Reduced expression of histone deacetylase 10 is associated lung cancer
11861901 molecular cloning and characterization of a novel class II histone deacetylase
11739383 another histone deacetylase

AA Sequence

MGTALVYHEDMTATRLLWDDPECEIERPERLTAALDRLRQRGLEQRCLRLSAREASEEELGLVHSPEYVS      1 - 70
LVRETQVLGKEELQALSGQFDAIYFHPSTFHCARLAAGAGLQLVDAVLTGAVQNGLALVRPPGHHGQRAA     71 - 140
ANGFCVFNNVAIAAAHAKQKHGLHRILVVDWDVHHGQGIQYLFEDDPSVLYFSWHRYEHGRFWPFLRESD    141 - 210
ADAVGRGQGLGFTVNLPWNQVGMGNADYVAAFLHLLLPLAFEFDPELVLVSAGFDSAIGDPEGQMQATPE    211 - 280
CFAHLTQLLQVLAGGRVCAVLEGGYHLESLAESVCMTVQTLLGDPAPPLSGPMAPCQSALESIQSARAAQ    281 - 350
APHWKSLQQQDVTAVPMSPSSHSPEGRPPPLLPGGPVCKAAASAPSSLLDQPCLCPAPSVRTAVALTTPD    351 - 420
ITLVLPPDVIQQEASALREETEAWARPHESLAREEALTALGKLLYLLDGMLDGQVNSGIAATPASAAAAT    421 - 490
LDVAVRRGLSHGAQRLLCVALGQLDRPPDLAHDGRSLWLNIRGKEAAALSMFHVSTPLPVMTGGFLSCIL    491 - 560
GLVLPLAYGFQPDLVLVALGPGHGLQGPHAALLAAMLRGLAGGRVLALLEENSTPQLAGILARVLNGEAP    561 - 630
PSLGPSSVASPEDVQALMYLRGQLEPQWKMLQCHPHLVA                                   631 - 669
//

Text Mined References (28)

PMID Year Title
26240284 2015 Histone Deacetylase 10 Regulates the Cell Cycle G2/M Phase Transition via a Novel Let-7-HMGA2-Cyclin A2 Pathway.
26221039 2015 Histone deacetylase 10 regulates DNA mismatch repair and may involve the deacetylation of MutS homolog 2.
25337229 2014 Decreased expression of histone deacetylase 10 predicts poor prognosis of gastric cancer patients.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24145760 2013 Histone deacetylase 10-promoted autophagy as a druggable point of interference to improve the treatment response of advanced neuroblastomas.
23897811 2013 Histone deacetylase (HDAC) 10 suppresses cervical cancer metastasis through inhibition of matrix metalloproteinase (MMP) 2 and 9 expression.
23801752 2013 Histone deacetylase 10 promotes autophagy-mediated cell survival.
21247901 2011 Histone deacetylases 9 and 10 are required for homologous recombination.
20680488 2010 Inhibition of histone deacetylase 10 induces thioredoxin-interacting protein and causes accumulation of reactive oxygen species in SNU-620 human gastric cancer cells.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20471694 2010 Association of histone deacetylase genes with schizophrenia in Korean population.
20032463 2010 Histone deacetylase 10 relieves repression on the melanogenic program by maintaining the deacetylation status of repressors.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17892858 2007 HDAC10 promoter polymorphism associated with development of HCC among chronic HBV patients.
17172643 2007 Multiple histone deacetylases and the CREB-binding protein regulate pre-mRNA 3'-end processing.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15305372 2004 Reduced expression of class II histone deacetylase genes is associated with poor prognosis in lung cancer patients.
14759258 2004 An unappreciated role for RNA surveillance.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11861901 2002 Identification of HDAC10, a novel class II human histone deacetylase containing a leucine-rich domain.
11739383 2002 Isolation and characterization of a novel class II histone deacetylase, HDAC10.
11726666 2002 Molecular cloning and characterization of a novel histone deacetylase HDAC10.
11677242 2002 Isolation and characterization of mammalian HDAC10, a novel histone deacetylase.
10591208 1999 The DNA sequence of human chromosome 22.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.