Property Summary

NCBI Gene PubMed Count 23
PubMed Score 52.78
PubTator Score 50.71

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.226 1.3e-02
tuberculosis 1.300 7.0e-08
non-small cell lung cancer -1.205 2.0e-15
intraductal papillary-mucinous carcinoma... -1.100 9.5e-05
interstitial cystitis 1.300 5.6e-04
lung carcinoma -1.200 1.3e-11

Protein-protein Interaction (3)

Gene RIF (11)

PMID Text
26508790 These results suggest that NKG2D-DAP10 endocytosis represents a means to decrease cell surface receptor abundance, as well as to control signaling outcome in cytotoxic lymphocytes.
25002577 findings indicate that the functional interaction between RAGE and DAP10 coordinately regulates S100A8/A9-mediated survival and/or apoptotic response of keratinocytes
22438812 TGF-beta1 may reduce the expression of NKG2D/DAP10 and 2B4/SAPin patients with hepatitis B.
21816829 Other gamma(c) cytokines act similarly to IL-2 in up-regulating DAP10 expression and NKG2D-DAP10 surface expression.
21789015 TGF-BETA1 down-modulates surface NKG2D expression by controlling the transcriptional and translational levels of DAP10.
21706044 HMBOX1 negatively regulates the expression of NKG2D and the activation of the NKG2D/DAP10 signaling pathway in NK cells.
21263069 A transgenic mouse model demonstrates that induction of tolerance in Ly49H-positive natural killer (NK) cells by chronic exposure to virus-encoded ligand m157 requires signaling through the Ly49H adaptor protein DAP12, not the DAP10 adaptor protein.
19329438 the rapid degradation of NKG2D/DAP10 observed coincident with recruitment of the receptor to the cytotoxic immune synapse may explain the loss of NKG2D receptor expression after chronic exposure to NKG2D ligands
19075187 Downstream targets of DAP10 and DAP12 are constitutively activated in large granular lymphocyte leukemia cells, and expression of dominant-negative DAP10 and DAP12 dramatically reduces their lytic capacity.
16339517 both activated and expanded CD8+ T cells and NK cells use DAP10 for cytolysis
12740575 NKG2D-DAP10 triggers human NK cell-mediated killing via a Syk-independent regulatory pathway.

AA Sequence

MIHLGHILFLLLLPVAAAQTTPGERSSLPAFYPGTSGSCSGCGSLSLPLLAGLVAADAVASLLIVGAVFL      1 - 70
CARPRRSPAQEDGKVYINMPGRG                                                    71 - 93
//

Text Mined References (32)

PMID Year Title
26508790 2015 Ubiquitin-dependent endocytosis of NKG2D-DAP10 receptor complexes activates signaling and functions in human NK cells.
26221034 2015 Identification and Characterization of CD300H, a New Member of the Human CD300 Immunoreceptor Family.
25002577 2014 DNAX-activating protein 10 (DAP10) membrane adaptor associates with receptor for advanced glycation end products (RAGE) and modulates the RAGE-triggered signaling pathway in human keratinocytes.
22438812 2012 TGF-?1 down-regulation of NKG2D/DAP10 and 2B4/SAP expression on human NK cells contributes to HBV persistence.
21816829 2011 Complex regulation of human NKG2D-DAP10 cell surface expression: opposing roles of the ?c cytokines and TGF-?1.
21789015 A possible mechanism of impaired NK cytotoxicity in cancer patients: down-regulation of DAP10 by TGF-beta1.
21706044 2011 HMBOX1 negatively regulates NK cell functions by suppressing the NKG2D/DAP10 signaling pathway.
21263069 2011 Activation receptor-induced tolerance of mature NK cells in vivo requires signaling through the receptor and is reversible.
19329438 2009 The traffic of the NKG2D/Dap10 receptor complex during natural killer (NK) cell activation.
19075187 2009 A critical role for DAP10 and DAP12 in CD8+ T cell-mediated tissue damage in large granular lymphocyte leukemia.
18097042 2008 Regulation of human DAP10 gene expression in NK and T cells by Ap-1 transcription factors.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16582911 2006 NKG2D-mediated signaling requires a DAP10-bound Grb2-Vav1 intermediate and phosphatidylinositol-3-kinase in human natural killer cells.
16424177 2006 IL-21 down-regulates NKG2D/DAP10 expression on human NK and CD8+ T cells.
16339517 2005 Silencing human NKG2D, DAP10, and DAP12 reduces cytotoxicity of activated CD8+ T cells and NK cells.
16002667 2005 Systemic NKG2D down-regulation impairs NK and CD8 T cell responses in vivo.
15894612 2005 The activating NKG2D receptor assembles in the membrane with two signaling dimers into a hexameric structure.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15294961 2004 A Structural basis for the association of DAP12 with mouse, but not human, NKG2D.
15048706 2004 Comparative analysis of human NK cell activation induced by NKG2D and natural cytotoxicity receptors.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12740576 2003 NKG2D triggers cytotoxicity in mouse NK cells lacking DAP12 or Syk family kinases.
12740575 2003 NKG2D-DAP10 triggers human NK cell-mediated killing via a Syk-independent regulatory pathway.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12426565 2002 Selective associations with signaling proteins determine stimulatory versus costimulatory activity of NKG2D.
12426564 2002 NKG2D recruits two distinct adapters to trigger NK cell activation and costimulation.
11777960 2002 UL16-binding proteins, novel MHC class I-related proteins, bind to NKG2D and activate multiple signaling pathways in primary NK cells.
11398969 2001 Molecular cloning and characterization of pig immunoreceptor DAP10 and NKG2D.
11239445 2001 ULBPs, novel MHC class I-related molecules, bind to CMV glycoprotein UL16 and stimulate NK cytotoxicity through the NKG2D receptor.
11015446 2000 DAP10 and DAP12 form distinct, but functionally cooperative, receptor complexes in natural killer cells.
10528161 1999 Cutting edge: KAP10, a novel transmembrane adapter protein genetically linked to DAP12 but with unique signaling properties.
10426994 1999 An activating immunoreceptor complex formed by NKG2D and DAP10.