Property Summary

NCBI Gene PubMed Count 34
PubMed Score 0.00
PubTator Score 0.53

Knowledge Summary

Patent

No data available

Gene RIF (18)

PMID Text
25369137 Evidence of a higher risk to develop pericarditis with STAT4 genotypes, and an association between HCP5 rs3099844 and anti-Ro/SSA antibodies in Italian systemic lupus erythematosus patients.
25297839 Genome-wide association analyses in 22,981 participants (2280 shingles cases) from the electronic Medical Records and Genomics Network identified a genomic region in the combined and European ancestry groups that has an age of onset effect reaching genome-wide significance region tags the non-coding gene HCP5 (HLA Complex P5).
25264125 The aim of this study was to investigate whether the HCP5, TNIP1, TNFAIP3, SPATA2 and COG6 genes were genetic risk factors for psoriasis in Chinese population.
24322967 We confirmed the association of HCP5 with the Stevens Johnsons Syndrome/Toxic Epidermal Necrolysis susceptibility in a population from Mozambique treated with nevirapine
23665287 confirms the MICA/HCP5 region as a susceptibility locus for HCV-related hepatocellular carcinoma and identifies rs2244546 in HCP5 as a novel tagging SNP
21860345 assessed whether increases in viral load set points are associated with genetic markers in CCR5, HCP5, and HLA-C genes
21510768 Haplotype analysis revealed that HLA-B*5701 and the HCP5 rs2395029(G) allele are in complete LD (r(2) = 1) in this Mexican Mestizos sample.
21084992 Observational study of gene-disease association. (HuGE Navigator)
20559009 HLA-B44 allele is prevalent in Polish patients with chronic spontaneous urticaria
20534626 Observational study of genetic testing. (HuGE Navigator)
19935381 No significant HIV-1 restriction was observed in the cells throughout HIV-1 life cycle, suggesting that the association of HCP5 variant with viral control is likely due to HLA-B*5701-related effect or other functional variants in the haplotype or both
19851445 Observational study of gene-disease association. (HuGE Navigator)
19115949 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
19050382 Observational study of gene-disease association. (HuGE Navigator)
18982067 Data demonstrate that the influence of ZNRD1 alleles on disease progression rates are attributable to HLA-A10, help clarify the relationship between the HCP5, HLA-C and HLA-B*57 alleles, and reaffirm a critical role of HLA-B*57 alleles in HIV disease.
18982067 Observational study of gene-disease association. (HuGE Navigator)
18684101 HCP5 single nucleotide polymorphism genotyping can serve as a simple screening tool for prediction of hypersensitivity reactions to abacavir.
18684101 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)

AA Sequence

MLLRMSEHRNEALGNYLEMRLKSSFLRGLGSWKSNPLRLGGWTILLTLTMGQGEPGGPQGDPWVPHELLL      1 - 70
PSLCDSSHASSWGSGSITCAWRGGDSSSHPLVSGHILSNSPVAAVMCSSMGTHLSPFKGTLL             71 - 132
//

Text Mined References (38)

PMID Year Title
25369137 2014 A multilocus genetic study in a cohort of Italian SLE patients confirms the association with STAT4 gene and describes a new association with HCP5 gene.
25297839 Genetic variation in the HLA region is associated with susceptibility to herpes zoster.
25264125 2014 Investigating the genetic association of HCP5, SPATA2, TNIP1, TNFAIP3 and COG6 with psoriasis in Chinese population.
25187353 2014 Clozapine-induced agranulocytosis is associated with rare HLA-DQB1 and HLA-B alleles.
24586183 2014 Identification of novel genetic Loci associated with thyroid peroxidase antibodies and clinical thyroid disease.
24322967 2014 HCP5 genetic variant (RS3099844) contributes to Nevirapine-induced Stevens Johnsons Syndrome/Toxic Epidermal Necrolysis susceptibility in a population from Mozambique.
23665287 2013 Comparative genetic analyses point to HCP5 as susceptibility locus for HCV-associated hepatocellular carcinoma.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
22493691 2012 Novel associations for hypothyroidism include known autoimmune risk loci.
21912425 2013 A whole-genome association study of major determinants for allopurinol-related Stevens-Johnson syndrome and toxic epidermal necrolysis in Japanese patients.
21860345 2011 Rising HIV-1 viral load set point at a population level coincides with a fading impact of host genetic factors on HIV-1 control.
21801394 2011 Genome-wide association study of Stevens-Johnson Syndrome and Toxic Epidermal Necrolysis in Europe.
21510768 2011 Association of the genetic marker for abacavir hypersensitivity HLA-B*5701 with HCP5 rs2395029 in Mexican Mestizos.
21084992 2011 An additive effect of protective host genetic factors correlates with HIV nonprogression status.
21051598 2010 The major genetic determinants of HIV-1 control affect HLA class I peptide presentation.
20559009 2010 HLA status in patients with chronic spontaneous urticaria.
20534626 2010 Use of the HCP5 single nucleotide polymorphism to predict hypersensitivity reactions to abacavir: correlation with HLA-B*5701.
20041166 2009 Common genetic variation and the control of HIV-1 in humans.
19935381 2010 A polymorphism in the HCP5 gene associated with HLA-B*5701 does not restrict HIV-1 in vitro.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19483685 2009 HLA-B*5701 genotype is a major determinant of drug-induced liver injury due to flucloxacillin.
19115949 2009 Genomewide association study of an AIDS-nonprogression cohort emphasizes the role played by HLA genes (ANRS Genomewide Association Study 02).
19050382 2009 Association of HLA-C and HCP5 gene regions with the clinical course of HIV-1 infection.
18982067 2008 HIV-1 disease-influencing effects associated with ZNRD1, HCP5 and HLA-C alleles are attributable mainly to either HLA-A10 or HLA-B*57 alleles.
18684101 2008 The HCP5 single-nucleotide polymorphism: a simple screening tool for prediction of hypersensitivity reaction to abacavir.
18369459 2008 A genome-wide association study of psoriasis and psoriatic arthritis identifies new disease loci.
18301071 2008 The role of protective HCP5 and HLA-C associated polymorphisms in the control of HIV-1 replication in a subset of elite suppressors.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17641165 2007 A whole-genome association study of major determinants for host control of HIV-1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10553908 1999 Complete sequence and gene map of a human major histocompatibility complex. The MHC sequencing consortium.
10199916 1999 The P5 multicopy gene family in the MHC is related in sequence to human endogenous retroviruses HERV-L and HERV-16.
9799336 Physical mapping between the S and HLA-E genes in the human MHC class I region: construction of a BAC, PAC, and cosmid contig.
8462994 1993 A novel coding sequence belonging to a new multicopy gene family mapping within the human MHC class I region.
7894158 1994 Non-homologous recombination within the major histocompatibility complex creates a transcribed hybrid sequence.