Property Summary

Ligand Count 32
NCBI Gene PubMed Count 34
PubMed Score 5.03
PubTator Score 109.07

Knowledge Summary

Patent (6,041)

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -4.700 8.0e-06
astrocytic glioma -3.600 1.2e-03
Astrocytoma, Pilocytic -5.100 1.0e-10
atypical teratoid / rhabdoid tumor -5.700 8.9e-12
ependymoma -2.900 2.2e-02
glioblastoma -4.700 7.7e-12
group 3 medulloblastoma -2.200 4.2e-02
lung carcinoma 3.100 3.4e-15
medulloblastoma, large-cell -4.900 3.6e-07
oligodendroglioma -2.700 2.7e-02
primitive neuroectodermal tumor -4.900 1.5e-06

Gene RIF (21)

AA Sequence

MEGGGKPNSSSNSRDDGNSVFPAKASATGAGPAAAEKRLGTPPGGGGAGAKEHGNSVCFKVDGGGGGGGG      1 - 70
GGGGEEPAGGFEDAEGPRRQYGFMQRQFTSMLQPGVNKFSLRMFGSQKAVEKEQERVKTAGFWIIHPYSD     71 - 140
FRFYWDLIMLIMMVGNLVIIPVGITFFTEQTTTPWIIFNVASDTVFLLDLIMNFRTGTVNEDSSEIILDP    141 - 210
KVIKMNYLKSWFVVDFISSIPVDYIFLIVEKGMDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQ    211 - 280
WEEIFHMTYDLASAVVRIFNLIGMMLLLCHWDGCLQFLVPLLQDFPPDCWVSLNEMVNDSWGKQYSYALF    281 - 350
KAMSHMLCIGYGAQAPVSMSDLWITMLSMIVGATCYAMFVGHATALIQSLDSSRRQYQEKYKQVEQYMSF    351 - 420
HKLPADMRQKIHDYYEHRYQGKIFDEENILNELNDPLREEIVNFNCRKLVATMPLFANADPNFVTAMLSK    421 - 490
LRFEVFQPGDYIIREGAVGKKMYFIQHGVAGVITKSSKEMKLTDGSYFGEICLLTKGRRTASVRADTYCR    491 - 560
LYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLQKFQKDLNTGVFNNQENEILKQIVKHDR    561 - 630
EMVQAIAPINYPQMTTLNSTSSTTTPTSRMRTQSPPVYTATSLSHSNLHSPSPSTQTPQPSAILSPCSYT    631 - 700
TAVCSPPVQSPLAARTFHYASPTASQLSLMQQQPQQQVQQSQPPQTQPQQPSPQPQTPGSSTPKNEVHKS    701 - 770
TQALHNTNLTREVRPLSASQPSLPHEVSTLISRPHPTVGESLASIPQPVTAVPGTGLQAGGRSTVPQRVT    771 - 840
LFRQMSSGAIPPNRGVPPAPPPPAAALPRESSSVLNTDPDAEKPRFASNL                        841 - 890
//

Text Mined References (37)

PMID Year Title