Property Summary

NCBI Gene PubMed Count 45
PubMed Score 11.19
PubTator Score 35.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
adrenocortical carcinoma -2.023 1.9e-04
adult high grade glioma 1.100 3.1e-02
astrocytoma 1.200 3.2e-09
Astrocytoma, Pilocytic 1.900 5.9e-09
chronic kidney disease 1.300 1.4e-02
cutaneous lupus erythematosus 1.200 2.2e-02
cystic fibrosis 1.414 8.5e-05
Down syndrome 1.100 4.4e-02
Duchenne muscular dystrophy 1.062 3.5e-09
glioblastoma 3.100 1.2e-04
group 4 medulloblastoma -1.200 3.7e-04
interstitial cystitis 1.700 6.6e-04
intraductal papillary-mucinous carcinoma... -2.100 3.6e-03
intraductal papillary-mucinous neoplasm ... -2.300 1.5e-02
invasive ductal carcinoma 1.560 1.3e-04
juvenile dermatomyositis 1.368 7.9e-09
lung cancer -3.300 4.9e-04
lung carcinoma -1.800 1.8e-23
malignant mesothelioma 7.600 3.3e-10
medulloblastoma, large-cell -2.000 1.7e-05
Multiple myeloma 1.505 1.9e-03
nephrosclerosis 1.273 8.3e-04
osteosarcoma -2.041 6.9e-03
ovarian cancer -1.700 2.2e-04
periodontitis 1.200 4.5e-30
primary Sjogren syndrome 1.500 4.7e-04
subependymal giant cell astrocytoma 2.115 2.4e-02
ulcerative colitis 3.000 3.5e-06

Protein-protein Interaction (2)

Gene RIF (16)

AA Sequence

MWKSVVGHDVSVSVETQGDDWDTDPDFVNDISEKEQRWGAKTIEGSGRTEHINIHQLRNKVSEEHDVLRK      1 - 70
KEMESGPKASHGYGGRFGVERDRMDKSAVGHEYVAEVEKHSSQTDAAKGFGGKYGVERDRADKSAVGFDY     71 - 140
KGEVEKHTSQKDYSRGFGGRYGVEKDKWDKAALGYDYKGETEKHESQRDYAKGFGGQYGIQKDRVDKSAV    141 - 210
GFNEMEAPTTAYKKTTPIEAASSGTRGLKAKFESMAEEKRKREEEEKAQQVARRQQERKAVTKRSPEAPQ    211 - 280
PVIAMEEPAVPAPLPKKISSEAWPPVGTPPSSESEPVRTSREHPVPLLPIRQTLPEDNEEPPALPPRTLE    281 - 350
GLQVEEEPVYEAEPEPEPEPEPEPENDYEDVEEMDRHEQEDEPEGDYEEVLEPEDSSFSSALAGSSGCPA    351 - 420
GAGAGAVALGISAVAVYDYQGEGSDELSFDPDDVITDIEMVDEGWWRGRCHGHFGLFPANYVKLLE        421 - 486
//

Text Mined References (52)

PMID Year Title