Property Summary

NCBI Gene PubMed Count 87
PubMed Score 341.59
PubTator Score 2317.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis -1.700 6.1e-05
osteosarcoma -1.338 2.5e-05

Gene RIF (39)

PMID Text
26305326 These results demonstrate that distinct OGT-binding sites in HCF-1 promote proteolysis, and provide novel insights into the mechanism of this unusual protease activity.
26075789 O-GlcNAcylation of the transcription regulators Host Cell Factor-1 (HCF-1) and Ten-Eleven Translocation protein 2 (TET2) could be readily observed. Our study raises questions on the occurrence and abundance of O-GlcNAcylation as a histone modification
25740848 our work identifies plausible cellular consequences of missense HCFC1 variants and identifies likely and relevant disease mechanisms that converge on embryonic stages of brain development.
25595573 We report here two brothers with dysmorphic features and complex malformations resulting from an X-linked inherited cobalamin deficiency due to HCFC1 gene mutation.
25472883 HIV-1 Tat specifically associates with HCFC1 promoter to downregulate HCFC1 expression in T cells
25437553 THAP11, ZNF143, and HCF-1 form a mutually dependent complex on chromatin, which is independent of E2F occupancy.
24311690 study reports the tetratricopeptide-repeat domain of O-GlcNAc transferase binds the carboxyl-terminal portion of an HCF-1 proteolytic repeat such that the cleavage region lies in the glycosyltransferase active site above uridine diphosphate-GlcNAc; protein glycosylation and HCF-1 cleavage occur in the same active site
24011988 A missense mutation in a global transcriptional coregulator, HCFC1, was identified as the genetic basis of an X-linked form of combined methylmalonic acidemia and hyperhomocysteinemia.
23629655 MLL5 can associate with HCF-1 and then be recruited to E2F1-responsive promoters to stimulate H3K4 trimethylation and transcriptional activation.
23539139 HCFC1 is a common component of active human CpG-island promoters and coincides with ZNF143, THAP11, YY1, and GABP transcription factor occupancy.
23045687 HCF-1(N)-HCF-1(C) association via an integrated Fn3 structure permits an NLS to facilitate formation of a transcriptional regulatory complex
23000143 A noncoding, regulatory mutation was identified in the binding site of transcription factor YY1 in the HCFC1 gene in patients with nonsyndromic intellectual disability.
22883232 Host cell factor C1 recruits O-GlcNAc transferase to O-GlcNAcylate PGC-1alpha, and O-GlcNAcylation facilitates the binding of the deubiquitinase BAP1, thus protecting PGC-1alpha from degradation and promoting gluconeogenesis.
22371484 THAP11 was found to associate physically with the transcriptional coregulator HCF-1 (host cell factor 1) and recruit HCF-1 to target promoters
21484256 Studies suggest that BAP1 influences cell proliferation at G1/S by co-regulating transcription from HCF-1/E2F-governed promoters.
21295698 These results reveal an unexpected role of OGT in HCF-1 proteolytic maturation and an unforeseen nexus between OGT-directed O-GlcNAcylation and proteolytic maturation in HCF-1 cell-cycle regulation.
20805357 HCF-1 interacts with the middle region of YY1 encompassing the glycine-lysine-rich domain and is essential for the formation of a ternary complex with YY1 and BAP1 in vivo.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20200153 THAP1 mediates the recruitment of HCF-1 to the RRM1 promoter during endothelial cell proliferation and that HCF-1 is essential for transcriptional activation of RRM1.
20133788 Data show that Asf1b localizes with HCF-1 in viral replication foci and depletion of Asf1b results in significantly reduced viral DNA accumulation.
20126307 Data show that the HCF-1 Basic region displays striking structural flexibility for controlling cell proliferation.
20018852 NSL is composed of nine subunits. Two of its subunits, WD repeat domain 5 (WDR5) and host cell factor 1 (HCF1), are shared with members of the MLL/SET family of histone H3 lysine 4 (H3K4) methyltransferase complexes.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19815555 BAP1 regulates cell proliferation by deubiquitinating HCF-1
19763085 Sequence changes in the E2F1 HCF-1-binding site can modulate both up and down the ability of E2F1 to induce apoptosis indicating that HCF-1 association with E2F1 is a regulator of E2F1-induced apoptosis.
19292868 The most interesting biological findings were the binding sites for SREBP-1 in genes for host cell factor C1 (HCFC1), involved in cell cycle regulation
19131338 The identified components revealed factors involved in histone methylation and cell cycle control and include Ash2L, RbBP5, WDR5, HCF-1, DBC-1, and EMSY.
18520591 A viable hypothesis for disease development is presented based on the known interaction between HCFC1 and the herpes simplex viral protein VP16
18520591 Observational study of gene-disease association. (HuGE Navigator)
18343819 The results are consistent with a pathway whereby PRC regulates NRF-2-dependent genes through a multiprotein complex involving HCF-1.
17612494 During the G1-to-S phase transition, HCF-1 recruits the mixed-lineage leukemia (MLL) and Set-1 histone H3 lysine 4 methyltransferases to E2F-responsive promoters and induces histone methylation and transcriptional activation.
17578910 HCF-1 was required for recruitment of the histone methyltransferases Set1 and MLL1, leading to histone H3K4 trimethylation and transcriptional activation.
16042417 The fibronectin domain of HCF interacts with HCF in the herpes simplex virus VP16-induced transcriptional activating complex, an association requiring a region outside the putative HCF beta-propeller fold
15931389 Altered expression is associated with therapy failure and death in patients with multiple types of cancer.
14532282 Three proteins found to contain the HCF-binding motif were further analyzed for their ability to use HCF-1 as a coactivator. Krox20 and E2F4 showed a strong requirement for HCF-1 to activate activation transcription, while estrogen receptor-alpha did not.
12743030 These results suggest that host cell factor-1 (HCF-1) links the regulation of exit from mitosis and the G(1) phase of cell growth, possibly to coordinate the reactivation of gene expression after mitosis.
12670868 The results presented in this paper suggest that HCF-1 can broadly regulate transcription, both positively and negatively, through selective modulation of chromatin structure.
12271126 HCF-1 contains an activation domain (HCF-1(AD)) required for maximal transactivation by VP16 and its cellular counterpart LZIP.
12235138 HCF-1 activity is regulated by HPIP by modulating its subcellular localization

AA Sequence

MASAVSPANLPAVLLQPRWKRVVGWSGPVPRPRHGHRAVAIKELIVVFGGGNEGIVDELHVYNTATNQWF      1 - 70
IPAVRGDIPPGCAAYGFVCDGTRLLVFGGMVEYGKYSNDLYELQASRWEWKRLKAKTPKNGPPPCPRLGH     71 - 140
SFSLVGNKCYLFGGLANDSEDPKNNIPRYLNDLYILELRPGSGVVAWDIPITYGVLPPPRESHTAVVYTE    141 - 210
KDNKKSKLVIYGGMSGCRLGDLWTLDIDTLTWNKPSLSGVAPLPRSLHSATTIGNKMYVFGGWVPLVMDD    211 - 280
VKVATHEKEWKCTNTLACLNLDTMAWETILMDTLEDNIPRARAGHCAVAINTRLYIWSGRDGYRKAWNNQ    281 - 350
VCCKDLWYLETEKPPPPARVQLVRANTNSLEVSWGAVATADSYLLQLQKYDIPATAATATSPTPNPVPSV    351 - 420
PANPPKSPAPAAAAPAVQPLTQVGITLLPQAAPAPPTTTTIQVLPTVPGSSISVPTAARTQGVPAVLKVT    421 - 490
GPQATTGTPLVTMRPASQAGKAPVTVTSLPAGVRMVVPTQSAQGTVIGSSPQMSGMAALAAAAAATQKIP    491 - 560
PSSAPTVLSVPAGTTIVKTMAVTPGTTTLPATVKVASSPVMVSNPATRMLKTAAAQVGTSVSSATNTSTR    561 - 630
PIITVHKSGTVTVAQQAQVVTTVVGGVTKTITLVKSPISVPGGSALISNLGKVMSVVQTKPVQTSAVTGQ    631 - 700
ASTGPVTQIIQTKGPLPAGTILKLVTSADGKPTTIITTTQASGAGTKPTILGISSVSPSTTKPGTTTIIK    701 - 770
TIPMSAIITQAGATGVTSSPGIKSPITIITTKVMTSGTGAPAKIITAVPKIATGHGQQGVTQVVLKGAPG    771 - 840
QPGTILRTVPMGGVRLVTPVTVSAVKPAVTTLVVKGTTGVTTLGTVTGTVSTSLAGAGGHSTSASLATPI    841 - 910
TTLGTIATLSSQVINPTAITVSAAQTTLTAAGGLTTPTITMQPVSQPTQVTLITAPSGVEAQPVHDLPVS    911 - 980
ILASPTTEQPTATVTIADSGQGDVQPGTVTLVCSNPPCETHETGTTNTATTTVVANLGGHPQPTQVQFVC    981 - 1050
DRQEAAASLVTSTVGQQNGSVVRVCSNPPCETHETGTTNTATTATSNMAGQHGCSNPPCETHETGTTNTA   1051 - 1120
TTAMSSVGANHQRDARRACAAGTPAVIRISVATGALEAAQGSKSQCQTRQTSATSTTMTVMATGAPCSAG   1121 - 1190
PLLGPSMAREPGGRSPAFVQLAPLSSKVRLSSPSIKDLPAGRHSHAVSTAAMTRSSVGAGEPRMAPVCES   1191 - 1260
LQGGSPSTTVTVTALEALLCPSATVTQVCSNPPCETHETGTTNTATTSNAGSAQRVCSNPPCETHETGTT   1261 - 1330
HTATTATSNGGTGQPEGGQQPPAGRPCETHQTTSTGTTMSVSVGALLPDATSSHRTVESGLEVAAAPSVT   1331 - 1400
PQAGTALLAPFPTQRVCSNPPCETHETGTTHTATTVTSNMSSNQDPPPAASDQGEVESTQGDSVNITSSS   1401 - 1470
AITTTVSSTLTRAVTTVTQSTPVPGPSVPPPEELQVSPGPRQQLPPRQLLQSASTALMGESAEVLSASQT   1471 - 1540
PELPAAVDLSSTGEPSSGQESAGSAVVATVVVQPPPPTQSEVDQLSLPQELMAEAQAGTTTLMVTGLTPE   1541 - 1610
ELAVTAAAEAAAQAAATEEAQALAIQAVLQAAQQAVMGTGEPMDTSEAAATVTQAELGHLSAEGQEGQAT   1611 - 1680
TIPIVLTQQELAALVQQQQLQEAQAQQQHHHLPTEALAPADSLNDPAIESNCLNELAGTVPSTVALLPST   1681 - 1750
ATESLAPSNTFVAPQPVVVASPAKLQAAATLTEVANGIESLGVKPDLPPPPSKAPMKKENQWFDVGVIKG   1751 - 1820
TNVMVTHYFLPPDDAVPSDDDLGTVPDYNQLKKQELQPGTAYKFRVAGINACGRGPFSEISAFKTCLPGF   1821 - 1890
PGAPCAIKISKSPDGAHLTWEPPSVTSGKIIEYSVYLAIQSSQAGGELKSSTPAQLAFMRVYCGPSPSCL   1891 - 1960
VQSSSLSNAHIDYTTKPAIIFRIAARNEKGYGPATQVRWLQETSKDSSGTKPANKRPMSSPEMKSAPKKS   1961 - 2030
KADGQ                                                                    2031 - 2035
//

Text Mined References (107)

PMID Year Title
26305326 2015 Distinct OGT-Binding Sites Promote HCF-1 Cleavage.
26075789 2015 Undetectable histone O-GlcNAcylation in mammalian cells.
25740848 2015 HCFC1 loss-of-function mutations disrupt neuronal and neural progenitor cells of the developing brain.
25595573 2015 Multiple congenital anomalies in two boys with mutation in HCFC1 and cobalamin disorder.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25437553 2014 Host cell factor-1 recruitment to E2F-bound and cell-cycle-control genes is mediated by THAP11 and ZNF143.
24311690 2013 HCF-1 is cleaved in the active site of O-GlcNAc transferase.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24211834 2013 BAP1 is phosphorylated at serine 592 in S-phase following DNA damage.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24011988 2013 An X-linked cobalamin disorder caused by mutations in transcriptional coregulator HCFC1.
23870121 2013 SET1 and p300 act synergistically, through coupled histone modifications, in transcriptional activation by p53.
23629655 2013 Mixed lineage leukemia 5 (MLL5) protein regulates cell cycle progression and E2F1-responsive gene expression via association with host cell factor-1 (HCF-1).
23539139 2013 HCFC1 is a common component of active human CpG-island promoters and coincides with ZNF143, THAP11, YY1, and GABP transcription factor occupancy.
23353889 2013 TET2 and TET3 regulate GlcNAcylation and H3K4 methylation through OGT and SET1/COMPASS.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23045687 2012 HCF-1 self-association via an interdigitated Fn3 structure facilitates transcriptional regulatory complex formation.
23000143 2012 A noncoding, regulatory mutation implicates HCFC1 in nonsyndromic intellectual disability.
22883232 2012 O-GlcNAc transferase/host cell factor C1 complex regulates gluconeogenesis by modulating PGC-1? stability.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22371484 2012 A transcriptional regulatory role of the THAP11-HCF-1 complex in colon cancer cell function.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21909281 2011 The evolutionarily conserved longevity determinants HCF-1 and SIR-2.1/SIRT1 collaborate to regulate DAF-16/FOXO.
21484256 2011 An emerging model for BAP1's role in regulating cell cycle progression.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21295698 2011 O-GlcNAc transferase catalyzes site-specific proteolysis of HCF-1.
21285374 2011 Crosstalk between O-GlcNAcylation and proteolytic cleavage regulates the host cell factor-1 maturation pathway.
21269460 2011 Initial characterization of the human central proteome.
20805357 2010 The ubiquitin carboxyl hydrolase BAP1 forms a ternary complex with YY1 and HCF-1 and is a critical regulator of gene expression.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20622854 2010 PHF8 mediates histone H4 lysine 20 demethylation events involved in cell cycle progression.
20200153 2010 The THAP-zinc finger protein THAP1 associates with coactivator HCF-1 and O-GlcNAc transferase: a link between DYT6 and DYT3 dystonias.
20133788 2010 Transcriptional coactivator HCF-1 couples the histone chaperone Asf1b to HSV-1 DNA replication components.
20126307 2010 Role of the HCF-1 basic region in sustaining cell proliferation.
20091349 2010 Cell death of chondrocytes is a combination between apoptosis and autophagy during the pathogenesis of Osteoarthritis within an experimental model.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20018852 2010 Subunit composition and substrate specificity of a MOF-containing histone acetyltransferase distinct from the male-specific lethal (MSL) complex.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19815555 2009 The deubiquitinating enzyme BAP1 regulates cell growth via interaction with HCF-1.
19763085 2009 E2F1 mediates DNA damage and apoptosis through HCF-1 and the MLL family of histone methyltransferases.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19615732 2009 Defining the human deubiquitinating enzyme interaction landscape.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19377461 2009 GlcNAcylation of a histone methyltransferase in retinoic-acid-induced granulopoiesis.
19292868 2009 Novel genes in cell cycle control and lipid metabolism with dynamically regulated binding sites for sterol regulatory element-binding protein 1 and RNA polymerase II in HepG2 cells detected by chromatin immunoprecipitation with microarray detection.
19188440 2009 Association of C-terminal ubiquitin hydrolase BRCA1-associated protein 1 with cell cycle regulator host cell factor 1.
19131338 2009 Identification and characterization of a novel nuclear protein complex involved in nuclear hormone receptor-mediated gene regulation.
18838538 2008 Molecular regulation of H3K4 trimethylation by Wdr82, a component of human Set1/COMPASS.
18838386 2008 Human ATAC Is a GCN5/PCAF-containing acetylase complex with a novel NC2-like histone fold module that interacts with the TATA-binding protein.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18585351 2008 Ronin is essential for embryogenesis and the pluripotency of mouse embryonic stem cells.
18520591 2008 Sequence variants in host cell factor C1 are associated with Ménière's disease.
18391022 2008 A novel protein, Luman/CREB3 recruitment factor, inhibits Luman activation of the unfolded protein response.
18343819 2008 PGC-1-related coactivator complexes with HCF-1 and NRF-2beta in mediating NRF-2(GABP)-dependent respiratory gene expression.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17998332 2008 Wdr82 is a C-terminal domain-binding protein that recruits the Setd1A Histone H3-Lys4 methyltransferase complex to transcription start sites of transcribed human genes.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17612494 2007 E2F activation of S phase promoters via association with HCF-1 and the MLL family of histone H3K4 methyltransferases.
17578910 2007 The coactivator host cell factor-1 mediates Set1 and MLL1 H3K4 trimethylation at herpesvirus immediate early promoters for initiation of infection.
17567994 2007 Prominent use of distal 5' transcription start sites and discovery of a large number of additional exons in ENCODE regions.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16633736 2006 Host cell factor-1 and E2F4 interact via multiple determinants in each protein.
16624878 2006 Site-specific proteolysis of the transcriptional coactivator HCF-1 can regulate its interaction with protein cofactors.
16042417 2005 Purification and characterization of the Caenorhabditis elegans HCF protein and domains of human HCF.
15966902 2005 GABP, HCF-1 and YY1 are involved in Rb gene expression during myogenesis.
15960975 2005 Physical association and coordinate function of the H3 K4 methyltransferase MLL1 and the H4 K16 acetyltransferase MOF.
15931389 2005 Microarray analysis identifies a death-from-cancer signature predicting therapy failure in patients with multiple types of cancer.
15772651 2005 The DNA sequence of the human X chromosome.
15705566 2005 Zhangfei is a potent and specific inhibitor of the host cell factor-binding transcription factor Luman.
15522876 2005 Combinatorial transcription of herpes simplex virus and varicella zoster virus immediate early genes is strictly determined by the cellular coactivator HCF-1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15200950 2004 A switch in mitotic histone H4 lysine 20 methylation status is linked to M phase defects upon loss of HCF-1.
15199122 2004 Leukemia proto-oncoprotein MLL forms a SET1-like histone methyltransferase complex with menin to regulate Hox gene expression.
15190068 2004 A protein sequestering system reveals control of cellular programs by the transcriptional coactivator HCF-1.
14532282 2003 HCF-1 functions as a coactivator for the zinc finger protein Krox20.
12743030 2003 Proteolytic processing is necessary to separate and ensure proper cell growth and cytokinesis functions of HCF-1.
12670868 2003 Human Sin3 deacetylase and trithorax-related Set1/Ash2 histone H3-K4 methyltransferase are tethered together selectively by the cell-proliferation factor HCF-1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12271126 2002 An activation domain in the C-terminal subunit of HCF-1 is important for transactivation by VP16 and LZIP.
12244100 2002 Host cell factor-1 interacts with and antagonizes transactivation by the cell cycle regulatory factor Miz-1.
12235138 2002 Interaction of HCF-1 with a cellular nuclear export factor.
11340173 2001 Loss of HCF-1-chromatin association precedes temperature-induced growth arrest of tsBN67 cells.
10984507 2000 N-terminal transcriptional activation domain of LZIP comprises two LxxLL motifs and the host cell factor-1 binding motif.
10976766 2000 A set of proteins interacting with transcription factor Sp1 identified in a two-hybrid screening.
10958670 2000 HCF-1 amino- and carboxy-terminal subunit association through two separate sets of interaction modules: involvement of fibronectin type 3 repeats.
10920196 2000 Autocatalytic proteolysis of the transcription factor-coactivator C1 (HCF): a potential role for proteolytic regulation of coactivator function.
10871379 2000 Zhangfei: a second cellular protein interacts with herpes simplex virus accessory factor HCF in a manner similar to Luman and VP16.
10779346 2000 A novel 50-kilodalton fragment of host cell factor 1 (C1) in G(0) cells.
10675337 2000 The novel coactivator C1 (HCF) coordinates multiprotein enhancer formation and mediates transcription activation by GABP.
10637318 2000 Association of a protein phosphatase 1 activity with the human factor C1 (HCF) complex.
10629049 2000 Mutations in host cell factor 1 separate its role in cell proliferation from recruitment of VP16 and LZIP.
10623756 2000 Potential role for luman, the cellular homologue of herpes simplex virus VP16 (alpha gene trans-inducing factor), in herpesvirus latency.
9990006 1999 Nuclear localization of the C1 factor (host cell factor) in sensory neurons correlates with reactivation of herpes simplex virus from latency.
9889203 1999 HCF-dependent nuclear import of VP16.
9389645 1997 Viral mimicry: common mode of association with HCF by VP16 and the cellular protein LZIP.
9315674 1997 VP16 targets an amino-terminal domain of HCF involved in cell cycle progression.
9271389 1997 Luman, a new member of the CREB/ATF family, binds to herpes simplex virus VP16-associated host cellular factor.
8661027 1996 The complete sequence of the host cell factor 1 (HCFC1) gene and its promoter: a role for YY1 transcription factor in the regulation of its expression.
8392914 1993 The VP16 accessory protein HCF is a family of polypeptides processed from a large precursor protein.
7876203 1995 The cellular C1 factor of the herpes simplex virus enhancer complex is a family of polypeptides.
7829097 1994 Genomic organization of the human VP16 accessory protein, a housekeeping gene (HCFC1) mapping to Xq28.
7590226 1995 The HCF repeat is an unusual proteolytic cleavage signal.
1870093 1991 Localisation of the MRX3 gene for non-specific X linked mental retardation.
1605216 1992 Nomenclature guidelines for X-linked mental retardation.