Property Summary

Ligand Count 10
NCBI Gene PubMed Count 23
PubMed Score 15.56
PubTator Score 72.27

Knowledge Summary

Patent (12,403)

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
breast carcinoma -1.300 4.5e-03
lung adenocarcinoma -1.200 8.5e-08
lung carcinoma -1.800 4.5e-13
mucosa-associated lymphoid tissue lympho... 2.065 1.9e-02
psoriasis 1.100 4.4e-26

Gene RIF (14)

AA Sequence

MNRHHLQDHFLEIDKKNCCVFRDDFIAKVLPPVLGLEFIFGLLGNGLALWIFCFHLKSWKSSRIFLFNLA      1 - 70
VADFLLIICLPFVMDYYVRRSDWKFGDIPCRLVLFMFAMNRQGSIIFLTVVAVDRYFRVVHPHHALNKIS     71 - 140
NWTAAIISCLLWGITVGLTVHLLKKKLLIQNGTANVCISFSICHTFRWHEAMFLLEFFLPLGIILFCSAR    141 - 210
IIWSLRQRQMDRHAKIKRAITFIMVVAIVFVICFLPSVVVRIHIFWLLHTSGTQNCEVYRSVDLAFFITL    211 - 280
SFTYMNSMLDPVVYYFSSPSFPNFFSTLINRCLQRKITGEPDNNRSTSVELTGDPNKTRGAPEALIANSG    281 - 350
EPWSPSYLGPTSNNHSKKGHCHQEPASLEKQLGCCIE                                     351 - 387
//

Text Mined References (25)

PMID Year Title