Property Summary

NCBI Gene PubMed Count 23
PubMed Score 15.24
PubTator Score 72.27

Knowledge Summary

Patent (12,403)

TINX Plot

Gene RIF (14)

PMID Text
26656756 new insights into the G protein coupling profiles of the HCA receptors and the function of the receptor's C terminus
25839160 HCA1/3 are necessary for breast cancer cells to balance lipid/fatty acid metabolism.
22289163 Activated HCAR3 signals to MAP kinase cascades via the PLC-dependent PKC and MMP-mediated EGFR pathways
21655214 In contrast, in a squamous cell carcinoma derived cell line, both GPR109A and GPR109B show a more diffuse cellular localization and the receptors are nearly non-functional.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20380810 these results demonstrate that GPR109A and GPR109B dimerization is a constitutive process occurring early during biosynthesis.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19633298 Data show that the coordinated PPARgamma-mediated regulation of the GPR81, GPR109A and GPR109B presents a novel mechanism by which TZDs may reduce circulating free fatty acid levels and perhaps ameliorate insulin resistance in obese patients.
19561068 the ligand receptor pair 3-OH-octanoic acid/GPR109B mediates a negative feedback regulation of adipocyte lipolysis in human but not in mouse
19502010 An A allele in HM74 was significantly associated with schizophrenia and with schizophrenia plus bipolar disorder combined.
19502010 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19460752 Knockdown of hydroxycarboxylic acid receptor 3 (HCAR3) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19237584 These results suggest that aromatic D-amino acids elicit a chemotactic response in human neutrophils via activation of GPR109B.
12563315 HM74 is highly expressed in adipose tissue and is a nicotinic acid receptor

AA Sequence

MNRHHLQDHFLEIDKKNCCVFRDDFIAKVLPPVLGLEFIFGLLGNGLALWIFCFHLKSWKSSRIFLFNLA      1 - 70
VADFLLIICLPFVMDYYVRRSDWKFGDIPCRLVLFMFAMNRQGSIIFLTVVAVDRYFRVVHPHHALNKIS     71 - 140
NWTAAIISCLLWGITVGLTVHLLKKKLLIQNGTANVCISFSICHTFRWHEAMFLLEFFLPLGIILFCSAR    141 - 210
IIWSLRQRQMDRHAKIKRAITFIMVVAIVFVICFLPSVVVRIHIFWLLHTSGTQNCEVYRSVDLAFFITL    211 - 280
SFTYMNSMLDPVVYYFSSPSFPNFFSTLINRCLQRKITGEPDNNRSTSVELTGDPNKTRGAPEALIANSG    281 - 350
EPWSPSYLGPTSNNHSKKGHCHQEPASLEKQLGCCIE                                     351 - 387
//

Text Mined References (25)

PMID Year Title
26656756 2016 The role of the C-terminus of the human hydroxycarboxylic acid receptors 2 and 3 in G protein activation using G?-engineered yeast cells.
25839160 2015 Hydroxycarboxylic acid receptors are essential for breast cancer cells to control their lipid/fatty acid metabolism.
22289163 2012 Activated human hydroxy-carboxylic acid receptor-3 signals to MAP kinase cascades via the PLC-dependent PKC and MMP-mediated EGFR pathways.
21655214 2011 Nicotinic acid receptor abnormalities in human skin cancer: implications for a role in epidermal differentiation.
21454438 2011 International Union of Basic and Clinical Pharmacology. LXXXII: Nomenclature and Classification of Hydroxy-carboxylic Acid Receptors (GPR81, GPR109A, and GPR109B).
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20380810 2010 Evidence for constitutive dimerization of niacin receptor subtypes.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19633298 2009 Peroxisome proliferator-activated receptor gamma regulates expression of the anti-lipolytic G-protein-coupled receptor 81 (GPR81/Gpr81).
19561068 2009 Deorphanization of GPR109B as a receptor for the beta-oxidation intermediate 3-OH-octanoic acid and its role in the regulation of lipolysis.
19502010 2009 Two complex genotypes relevant to the kynurenine pathway and melanotropin function show association with schizophrenia and bipolar disorder.
19237584 2009 Aromatic D-amino acids act as chemoattractant factors for human leukocytes through a G protein-coupled receptor, GPR109B.
18983141 2008 Nicotinic acid receptor agonists.
17562024 2007 Large-scale identification of human genes implicated in epidermal barrier function.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12646212 2003 Molecular identification of nicotinic acid receptor.
12563315 2003 PUMA-G and HM74 are receptors for nicotinic acid and mediate its anti-lipolytic effect.
12522134 2003 Molecular identification of high and low affinity receptors for nicotinic acid.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12090300 2002 Mutation analysis of 12 candidate genes for distal hereditary motor neuropathy type II (distal HMN II) linked to 12q24.3.
9205127 1997 Isolation and chromosomal localization of GPR31, a human gene encoding a putative G protein-coupled receptor.
7505609 1993 Molecular cloning of cDNAs encoding a LD78 receptor and putative leukocyte chemotactic peptide receptors.