Property Summary

NCBI Gene PubMed Count 23
PubMed Score 32.51
PubTator Score 20.74

Knowledge Summary

Patent (3,242)

TINX Plot

  Disease (2)

Disease Target Count P-value
Breast cancer 3469 1.5e-06
Disease Target Count Z-score Confidence
late-onset retinal degenration 12 3.024 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
Breast cancer -2.500 1.5e-06

Gene RIF (12)

AA Sequence

MYNGSCCRIEGDTISQVMPPLLIVAFVLGALGNGVALCGFCFHMKTWKPSTVYLFNLAVADFLLMICLPF      1 - 70
RTDYYLRRRHWAFGDIPCRVGLFTLAMNRAGSIVFLTVVAADRYFKVVHPHHAVNTISTRVAAGIVCTLW     71 - 140
ALVILGTVYLLLENHLCVQETAVSCESFIMESANGWHDIMFQLEFFMPLGIILFCSFKIVWSLRRRQQLA    141 - 210
RQARMKKATRFIMVVAIVFITCYLPSVSARLYFLWTVPSSACDPSVHGALHITLSFTYMNSMLDPLVYYF    211 - 280
SSPSFPKFYNKLKICSLKPKQPGHSKTQRPEEMPISNLGRRSCISVANSFQSQSDGQWDPHIVEWH        281 - 346
//

Text Mined References (24)

PMID Year Title