Property Summary

NCBI Gene PubMed Count 29
PubMed Score 235.37
PubTator Score 52.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 2.1e-04

Gene RIF (4)

PMID Text
24751163 Data indicate a tetranucleotide 3'UTR motif that is required for the high-level accumulation of zeta-globin transcripts in cultured cells, and demonstrate that it prolongs their cytoplasmic half-lives.
15755797 The HBZ protein is localized to heterochromatin and capable of repressing JUN activity and viral transcription.
15555579 Hb zeta(2)beta(2)(S) exhibits an O(2) affinity as well as a Hill coefficient, Bohr response, and allosteric properties in vitro that are suboptimally suited for physiological O(2) transport in vivo
11747442 Chimeric zeta globin exhibits oxygen binding characteristics which fall within the range observed in adult human and human embryonic hemoglobins.

AA Sequence

MSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDA      1 - 70
VKSIDDIGGALSKLSELHAYILRVDPVNFKLLSHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEK     71 - 140
YR                                                                        141 - 142
//

Text Mined References (34)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24751163 2014 Structural determinants of human ?-globin mRNA stability.
24100324 2013 Structure of fully liganded Hb ?2?2s trapped in a tense conformation.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20925047 2010 Haemoglobin level, proportion of haemoglobin Bart's and haemoglobin Portland in fetuses affected by homozygous ?0-thalassemia from 12 to 40 weeks' gestation.
15755797 2005 Nuclear localization of HTLV-I bZIP factor (HBZ) is mediated by three distinct motifs.
15555579 2004 Effect of zeta-globin substitution on the O2-transport properties of Hb S in vitro and in vivo.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11747442 2001 The role of beta chains in the control of the hemoglobin oxygen binding function: chimeric human/mouse proteins, structure, and function.
11494285 2001 Embryonic and fetal globins are expressed in adult erythroid progenitor cells and in erythroid cell cultures.
11159543 2001 Expression, purification, and characterization of human hemoglobins Gower-1 (zeta(2)epsilon(2)), Gower-2 (alpha(2)epsilon(2)), and Portland-2 (zeta(2)beta(2)) assembled in complex transgenic-knockout mice.
11157797 2001 Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16.
10381533 1999 Embryonic hemoglobins are expressed in definitive cells.
9054936 1997 The relationship between chromosome structure and function at a human telomeric region.
7555018 1995 The multiple functions of hemoglobin.
7402334 1980 Partial deletion of the alpha-globin structural gene in human alpha-thalassaemia.
6963223 1982 Cloning and nucleotide sequence analysis of human embryonic zeta-globin cDNA.
6683087 1983 Separation of zeta (zeta) and various gamma (gamma) chains of human embryonic hemoglobin Portland I by reverse-phase high-performance liquid chromatography.
6539334 1984 Human hemoglobin Portland II (zeta 2 beta 2). Isolation and characterization of Portland hemoglobin components and their constituent globin chains.
6308667 1983 Molecular basis of length polymorphism in the human zeta-globin gene complex.
6297773 1982 The structure of the human zeta-globin gene and a closely linked, nearly identical pseudogene.
6179844 1981 [Human embryonic haemoglobins. The primary structure of the zeta chains (author's transl)].
6172357 1981 [Human embryonic haemoglobins. Ac-Ser-Leu-Thr-is the N-terminal sequence of the zeta-chains (author's transl)].
6171809 1981 Structure of the zeta chain of human embryonic hemoglobin.
6089189 1984 Distinctive sequence organization and functional programming of an Alu repeat promoter.
4135409 1974 Nucleotide sequences of human globin messenger RNA.
2649166 1989 A review of the molecular genetics of the human alpha-globin gene cluster.
2411938 1985 End-to-end transcription of an Alu family repeat. A new type of polymerase-III-dependent terminator and its evolutionary implication.
1939469 1991 Quantities of adult, fetal and embryonic globin chains in the blood of eighteen- to twenty-week-old human fetuses.
1549498 1992 Dinucleotide repeat polymorphism at the human hemoglobin alpha-1 pseudo-gene (HBAP1).
822353 1976 3' non-coding region sequences in eukaryotic messenger RNA.