Property Summary

NCBI Gene PubMed Count 698
PubMed Score 3708.08
PubTator Score 1063.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count
Anemia 365
Hypersplenism 10
Osteoporosis 363
Abnormal bone structure 4
Abnormal hemoglobin finding 8
Abnormality of metabolism/homeostasis 134
Abnormality of the skeletal system 11
Abnormality of the spleen 13
Anemia, Hemolytic 55
Anxiety 136
Anxiety disease 113
Aseptic Necrosis of Bone 8
Aseptic necrosis 8
Autosomal recessive predisposition 1442
Beta thalassemia intermedia 1
Bone infarction 8
Bone necrosis 9
Cardiomegaly 116
Chest Pain 38
Cholelithiasis 33
Chronic hemolytic anemia 3
Concave bridge of nose 195
Cooley's anemia 1
Delayed Puberty 97
Delta-Beta Thalassemia 3
Dental abnormalities 60
Depressed nasal bridge 195
Depressed nasal root/bridge 195
Depressive disorder 409
Dyspnea 76
Feeding difficulties 127
Fever 138
Foetal haemoglobin increased 7
Hematuria 36
Hemoglobin D disease 1
Hemoglobin E disease 3
Hemoglobin E/beta thalassemia disease 1
Hemoglobin F Disease 4
Hemoglobin M Disease 2
Hemoglobin SC Disease 1
Hemoglobin SD disease 1
Hemoglobin low 124
Hepatomegaly 285
Hyperferritinaemia 14
Hyperplasia of malar bones 4
Icterus 82
Immunologic Deficiency Syndromes 113
Increased ferritin 14
Increased number of platelets 14
Increased red cell sickling tendency 1
Infection of bone 19
Iron deficiency anemia 12
Iron-Refractory Iron Deficiency Anemia 15
Knee joint valgus deformity 56
Leukocytosis 17
Malabsorption 82
Microcytic hypochromic anemia (disorder) 10
Muscle Weakness 170
Nonspherocytic hemolytic anemia 6
Osteomyelitis 42
Pallor 40
Paresthesia 32
Pigment gallstones 2
Priapism 5
Prominent midface 4
Recurrent infections 48
Reduced alpha/beta synthesis ratio 3
Reduced beta/alpha synthesis ratio 2
Reticulocytosis 20
Retinal Diseases 55
Serum ferritin increased 14
Sickle cell-beta-thalassemia 1
Sickle cell-beta^+^-thalassemia 1
Sickle cell-hemoglobin E disease 1
Splenomegaly 190
Thrombocytosis 38
Tooth Abnormalities 69
Upward slant of palpebral fissure 75
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Malaria 160 3.472 1.7
Hemolytic anemia 77 0.0 3.0

Expression

  Differential Expression (36)

Disease log2 FC p
diabetes mellitus -2.300 4.5e-02
acute myeloid leukemia -5.000 3.0e-03
acute quadriplegic myopathy -1.724 3.3e-03
Atopic dermatitis -4.400 8.1e-05
atypical teratoid / rhabdoid tumor -1.800 4.6e-02
Breast cancer -1.500 7.6e-05
breast carcinoma -1.600 1.4e-02
chronic lymphosyte leukemia -3.500 2.8e-06
colon cancer -1.200 2.0e-02
Duchenne muscular dystrophy -1.519 2.7e-05
ductal carcinoma in situ -3.100 1.8e-04
ependymoma -1.400 2.0e-03
gastric cancer 3.100 4.1e-04
group 3 medulloblastoma -1.300 3.4e-03
head and neck cancer -6.700 3.7e-05
hepatocellular carcinoma 2.200 3.1e-03
intraductal papillary-mucinous adenoma (... -3.200 2.3e-03
intraductal papillary-mucinous carcinoma... -3.600 1.4e-03
intraductal papillary-mucinous neoplasm ... -4.100 1.7e-03
invasive ductal carcinoma -5.100 8.4e-05
juvenile dermatomyositis -3.235 1.2e-09
limb girdle muscular dystrophy 2B -1.054 3.1e-02
lung adenocarcinoma -2.300 5.0e-11
lung cancer -2.800 2.9e-05
lung carcinoma -3.000 1.6e-21
medulloblastoma, large-cell -1.900 2.1e-02
mucosa-associated lymphoid tissue lympho... 4.086 4.7e-03
non-small cell lung cancer -3.550 1.3e-25
ovarian cancer -9.000 4.5e-21
pancreatic cancer 3.400 2.3e-04
pancreatic carcinoma 3.400 2.3e-04
pancreatic ductal adenocarcinoma liver m... -2.433 9.4e-03
pediatric high grade glioma -1.200 1.4e-02
periodontitis 1.100 3.4e-12
tuberculosis 4.300 3.0e-04
Waldenstrons macroglobulinemia 3.432 3.6e-03

Protein-protein Interaction (1)

PDB (244)

Gene RIF (498)

AA Sequence

MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLG      1 - 70
AFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVAN     71 - 140
ALAHKYH                                                                   141 - 147
//

Text Mined References (727)

PMID Year Title