Property Summary

NCBI Gene PubMed Count 261
PubMed Score 3277.63
PubTator Score 1137.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Anemia 365
Abnormal hemoglobin finding 8
Abnormality of metabolism/homeostasis 134
Alpha thalassemia-mental retardation syndrome 1
Anemia, Hemolytic 55
Aplasia/Hypoplasia of the earlobes 10
Broad flat nasal bridge 236
Broad forehead 59
Byzanthine arch palate 194
Congenital Epicanthus 177
Congenital clubfoot 109
Congenital pectus carinatum 52
Congestive heart failure 113
Cryptorchidism 296
Downward slant of palpebral fissure 158
Dull intelligence 645
Ecchymosis 66
Failure to gain weight 365
Fatigue 182
Heart failure 162
Hemoglobin M Disease 2
Hemoglobin low 124
Hepatomegaly 285
High forehead 102
Hydrocephalus 152
Hydrops Fetalis 21
Hydrops Fetalis, Non-Immune 8
Hypoplastic mandible condyle 275
Hypoplastic toes 29
Hypotrophic malar bone 129
Increased tendency to bruise 66
Intellectual disability 1016
Iron-Refractory Iron Deficiency Anemia 15
Low intelligence 645
Low-set, posteriorly rotated ears 110
Malar flattening 129
Mandibular hypoplasia 275
Maternal oligohydramnios 31
Mental Retardation 645
Mental deficiency 645
Microcytic hypochromic anemia (disorder) 10
Micrognathism 275
Muscle hypotonia 571
Nasal bridge wide 236
Nonspherocytic hemolytic anemia 6
Oligohydramnios 52
Orbital separation excessive 244
Pallor 40
Pediatric failure to thrive 365
Polyhydramnios 108
Poor school performance 645
Pre-Eclampsia 68
Reduced alpha/beta synthesis ratio 3
Retrognathia 54
Short neck 140
Short stature 531
Small head 374
Speech Disorders 58
Splenomegaly 190
Tall forehead 102
Disease Target Count P-value
lung adenocarcinoma 2716 7.6e-10
facioscapulohumeral dystrophy 288 1.2e-02
breast carcinoma 1638 1.4e-02
Disease Target Count Z-score Confidence
Congenital hemolytic anemia 32 0.0 4.0

Expression

  Differential Expression (3)

Disease log2 FC p
breast carcinoma -2.100 2.0e-02
facioscapulohumeral dystrophy 2.800 3.9e-04
lung adenocarcinoma -3.500 7.2e-10

PDB (251)

Gene RIF (113)

AA Sequence

MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNA      1 - 70
VAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSK     71 - 140
YR                                                                        141 - 142
//

Text Mined References (355)

PMID Year Title