Property Summary

NCBI Gene PubMed Count 189
PubMed Score 410.35
PubTator Score 254.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

 GO Function (1)

Gene RIF (183)

PMID Text
27049082 decreased serum TIM-1 and TIM-3 levels and association of TIM-3 with nephritis suggest their possible role in the development and pathogenesis of systemic lupus erythematosus.
26930930 Data show that T cell immunoglobulin and mucin domain protein 3 (Tim-3) on peripheral blood CD4+ T cells is increased in advanced schistosomiasis patients.
26492563 TIM-3 is a negative regulator of TCR-function by attenuating activation signals mediated by CD3/CD28 co-stimulation.
26464703 Tim-3 played an important role in the development and progression of gastric cancer, and it could be used as an independent prognostic factor for gastric cancer patients.
26463635 Diffuse large B-cell lymphoma patients have high expression level of PD-1 and TIM-3, which are related to DLBCL staging. PD-1 and TIM-3 expression levels are also related to the efficiency of chemotherapy.
26428847 These data indicate that Tim-3 expression in NK cells can function as a prognostic biomarker in human lung adenocarcinoma and support that Tim-3 could be a new target for an immunotherapeutic strategy.
26413815 Tim-3 in primary leukocytes, both healthy and malignant AML cells, displays moderate properties of an inflammatory receptor with additional growth factor (mTOR activation) and pro-angiogenic (VEGF release) activities
26401029 Studied the effects of altered Tim-3 expression in vivo in mice and in vitro in human endothelial cells, on day 3 after Rickettsia heilongjiangensis infection.
26373631 sTim-3 was involved in the development of sepsis. The homeostasis-promoting role of the Tim-3 on the monocytes was disrupted, while the inhibitory role of sTim-3 emerged during sepsis-induced immunosuppression.
26342682 an abnormal Tim-3/Gal-9 pathway was able to facilitate the development of preeclampsia.
26339368 Tim-3 might participate in the tumorgenesis of colon cancer and Tim-3 expression might be a potential independent prognostic factor for patients with colorectal cancer.
26279267 TIM-3 and its ligand, galectin-9 (Gal-9), constitute an autocrine loop critical for leukemic stem cells self-renewal and development of human acute myeloid leukemia.
26265374 Tim-3 over-expression is associated with bladder urothelial carcinoma.
26239720 Study found that LGALS9 was expressed in 68.4% of the human gastrointestinal stromal tumors (GIST) and Tim-3 in the infiltrated NK cells of 68.4% of GISTs and suggest that Tim-3/LGALS9 pathway may be involved in the immune checkpoint mechanism of GISTs.
26215444 The functional decline of invariant natural killer T cells was closely related to the decrease in CD28 expression and the increases of Tim-3 and PD-1.
26214042 Our data indicate that Tim-3 expression on NK cells is regulated by T-bet, and that Tim-3 levels correlate with advanced stages of gastric cancer
26141233 IL-15 induces strong but short-lived tumor-infiltrating CD8 T cell responses through the regulation of Tim-3 in breast cancer.
26125859 there was no significant differ-ence in TIM-1 mRNA expression between the patients and the healthy controls. Our results suggest that insufficient expression of TIM-3 mRNA may be involved in the pathogenesis of nephropathy
26076826 Expression of Tim-3 and co-expression of Tim-3 and Fas on certain peripheral T subsets are associated with disease activity in systemic lupus erythematosus patients.
26062425 TIM-3, as a key negative regulator in the anti-tumor immunity, contributes to the tumor immune evasion
26008981 Results indicate that upregulation of the inhibitory receptor Tim-3 may restrict T cell responses in CRC patients.
25950468 Findings underline the important roles of Tim-3 and PD-1 pathways in regulating decidual CD8+ T-cell function and maintaining normal pregnancy.
25937557 TIM-3 polymorphism is associated with increased susceptibility to osteoarthritis.
25876049 Study found that the prevalence of Tim-3 rs200181745TG genotype and G allele was significantly increased in knee osteoarthritis. Furthermore, patients and controls with rs200181745TG genotype had up-regulated IFN-gamma mRNA and protein levels in CD4 + T cells.
25797693 In chronic hepatitis C virus (HCV)-infected subjects, there was increased Tim-3 on NK cells, which was associated with an activated phenotype.
25784621 Participation of TIM-3 and its ligand (galectin-9) in the pathogenesis of active generalized vitiligo
25772938 These data indicate that HCV-induced, miR-155-regulated Tim-3 expression regulates NK cell function, suggesting a novel mechanism for balancing immune clearance and immune injury during chronic viral infection.
25685816 The elevation of differential Tim-3 and PD-1 expression patterns on T cells represents a state of T cell exhaustion and can be induced by common gamma-chain cytokines
25685816 Treatment of PBMCs taken from treatment-naive HIV chronically infected individuals with a HIV-1 Gag peptide pool in the presence of ADAM10 inhibitor upregulates the levels of Tim-3 and IFN-gamma in CD8+ T cells
25609823 Authors show that Tim-3 is shed from the surface of responding CD8(+) T cells by the matrix metalloproteinase ADAM10, producing a soluble form of the coinhibitory receptor.
25609823 Treatment of PBMCs taken from treatment-naive HIV chronically infected individuals with a HIV-1 Gag peptide pool in the presence of ADAM10 inhibitor upregulates the levels of Tim-3 and IFN-gamma in CD8+ T cells
25578313 The Gal-9/Tim-3 signal is important for the regulation of decidua NK cells function, which is beneficial for the maintenance of a normal pregnancy.
25520133 High Tim-3 expression is associated with lung cancer.
25483439 Tim-3 triggers growth factor type responses in acute myeloid leukaemia cells by activating a phosphatidylinositol-3 kinase (PI-3K)/mammalian target of rapamycin (mTOR) pathway.
25400771 Tim-3 is highly expressed on the peripheral blood T cells of AML patients, and Tim-3 expression significantly correlates with clinicopathological prognostic stratification.
25375372 Tumor-induced senescent T cells promote the secretion of pro-inflammatory cytokines and angiogenic factors by human monocytes/macrophages through a mechanism that involves Tim-3 and CD40L.
25363763 CEACAM1 serves as a heterophilic ligand for TIM-3 that is required for its ability to mediate T-cell inhibition, and this interaction has a crucial role in regulating autoimmunity and anti-tumour immunity
25342285 Tim-3 levels were significantly decreased in CD4+ T cells and CD8+ cells from intracranial aneurysm patients compared to controls.
25220367 The presence of TIM3+and/or NKG2A+ T cells is associated with the absence of recurrences and a longer recurrence-free survival.
25180498 A positively selected polymorphism in the 3' UTR, which modulates HAVCR2 expression, is associated with the susceptibility to HIV-1 infection.
25136083 Our study uncovers a novel ability of TIM-family proteins to block the release of HIV-1 and other viruses by interaction with virion- and cell-associated phosphatidylserine.
25136083 Treatment of PBMCs taken from treatment-naive HIV chronically infected individuals with a HIV-1 Gag peptide pool in the presence of ADAM10 inhibitor upregulates the levels of Tim-3 and IFN-gamma in CD8+ T cells
25135732 It was suggested that the overexpression of Tim-3/Gal-9 pathway may be related to the pathogenesis of RSA.
25119597 High expression of Tim-3 was associated with prostate cancer.
25091272 Tim-3/Gal-9 interaction favors apoptosis of MBP-specific T lymphocytes in benign multiple sclerosis; this process is reduced in PPMS by the up-regulation of Bat3
24905803 TIM-3 polymorphism is associated with increased susceptibility to Ankylosing spondylitis possibly by downregulating gene expression.
24867713 Results show that genetic variants of Tim-3 have an important impact on disease progression of HBV infection. With specific Tim-3 polymorphisms, patients infected with HBV could be potential candidates of hepatocellular carcinoma and HBsAg seroclearance.
24855276 Suggest RepSox may reduce Tim-3 expression by inhibiting transforming growth factor-beta signaling and slow decay of CD34(+) AML cells by increasing CXCL12 and MYC, two factors that inhibit AML cell differentiation.
24845464 Expression of human Tim-3 on kidney tissue from immunoglobulin A nephropathy patients
24838857 Enhanced suppressor function of TIM-3+ FoxP3+ regulatory T cells.
24833097 revealed that patients with advanced tumor stages had elevated Tim-3 expression on CD4+ and CD8+ T cells compared to those with primary tumor stages
24825777 Tim-3 functions to inhibit T cell responses, particularly under conditions involving chronic stimulation.
24702227 elevated in cholesteatoma
24689929 The percentage of TIM-3 on both peripheral CD4+ and peripheral CD8+ T cells was negatively correlated with disease activity.
24651720 Galectin-9 expressing regulatory T cells, TIM-3+ cytotoxic T cells and NK cells could play an important role in the maintenance of healthy pregnancy.
24642562 Increased frequency of Tim-3 expressing T cells is associated with symptomatic West Nile virus infection.
24639110 Tim-3, which specifically expresses on LSCs, is beneficial for LSCs survival and AML progression by promoting expansion of MDSCs and differentiating into TAMs at the leukemia site
24512143 Tim-3 on peripheral CD4 and CD8 T cells is involved in the development of glioma.
24498204 blocking Tim-3 signaling significantly improved the innate and adaptive immune responses in chronically HCV-infected patients
24477913 neutrophil TIM-3/Gal-9 signaling is perturbed in the CF airways due to proteolytic degradation of the receptor.
24412470 The ratio of Tim-3 to Tim-1 in patients with active disease was significantly decreased compared with the ratios in the normal group and in the immune thrombocytopenia patients in remission.
24339967 The results suggest that expression of Gal-9 and Tim-3 in tumor cells may be a potential, independent prognostic factor for patients with gastric cancer. Gal-9 and TIM-3 may play an important part in the gastric carcinogenesis.
24337741 Tim-3 interacts with Lck.
24253699 The results showed that there was the expression of TIM-3 in renal tissue from the patients with systemic lupus erythematosus (SLE), but rarely expression in cases without SLE. Expression of TIM-3 was associated with the diseases' activity.
24231118 The decreased levels of Tim-3 during active stages of disease suggest a possible role in the pathogenesis and course of ITP and restoration of Tim-3 may be a reasonable therapeutic strategy for ITP.
24209883 Polymorphisms rs10053538 or rs10515746 in the Tim-3 promoter are not be associated with URSA in Han Chinese women.
24195506 Knockdown of TIM-3 suppressed the proliferation and invasion capacity of Clear cell renal carcinoma (ccRCC) cell lines.TIM-3 expression was associated with poor prognosis in ccRCC.
24121505 we describe Tim-3 as novel target for ADAM-mediated ectodomain shedding and suggest a role of Tim-3 shedding in TLR-mediated immune responses of CD14(+) monocytes.
24083425 Data indicate the expression of programmed cell death protein 1 (PD-1), inducible T-cell Costimulator (ICOS), Cytotoxic T-Lymphocyte Antigen 4 (CTLA-4) and T cell immunoglobulin and mucin protein 3 (Tim-3) in T-cells from geriatric and younger subjects.
24007284 expression of Tim-3 was significantly increased in both CD4+ and CD8+ T cells in ovarian cancer cases, suggesting that Tim-3 may participate in the development and progression of ovarian cancer by its negative regulation on various T-cell subsets
23967307 a ligand (Gal-9) compartment-dependent regulatory effect on receptor (Tim-3) activities and inflammatory responses via TLR pathways
23936526 Reduced TIM3 expression is associated with preeclampsia.
23922299 MCC-targeting T cells expand with tumor burden and express high levels of immune checkpoint receptors PD-1 and Tim-3. Reversal of these inhibitory pathways is therefore a promising therapeutic approach for this virus-driven cancer.
23886204 High TIM-3 expression is associated with prostate cancer.
23866914 Persistent Gal-9 production might impair Tim-3 activity and contribute to natural killer cell dysfunction in chronic HIV-1 infection.
23837986 Tim-3 expression, which is up-regulated on PBMs of CHB patients, is negatively correlated to the level of ALT in sera of IA CHB patients.
23791624 Mass spectrometry-based profiling of plasma from multiple subjects diagnosed with common diseases provided evidence for restricted release of soluble Tim-3 in the context of GVHD.
23773130 In patients with chronic hepatitis C, CD8+ T cells are positive for exhaustion markers (i.e., expressing both TIM-3 and PD-1) more frequently in the spleen and the liver, compared to the peripheral blood.
23665438 Altered expression of Tim-3 might play an important role in the pathogenesis of spontaneous intracerebral hemorrhage.
23526963 Tim-3-expressing CD4 T cells in tumors could represent the functional regulatory T cells which contribute to the formation of the immune-suppressive tumor micromilieu.
23388728 These findings suggest that Tim-3-mediated differential regulation of IL-12/IL-23 drives T(H)17 cell development, a milieu favoring viral persistence and autoimmune phenomenon during chronic hepatitis C.
23385979 These results suggested polymorphisms in TIM-3 gene could be new risk factors for non-Hodgkin lymphoma as well as HIV-related non-Hodgkin lymphoma and suggested a possible role of the inflammatory factor in these diseases.
23365080 Tim-3 negatively regulates the TLR4 response in sepsis patients.
23359271 Polymorphism in TIM-3 gene is associated with increased susceptibility to non-small-cell lung cancer
23335978 the expression of Tim-3 in tumor cells may be an independent prognostic factor for patients with cervical cancer. Moreover, Tim-3 expression may promote metastatic potential in cervical cancers.
23334427 These results suggest that the imbalanced expression of Tim-3 and T-bet may play a role in the pathogenesis and course of aplastic anaemia (AA), and the downregulation of T-bet/Tim-3 may represent a reasonable therapeutic strategy for AA treatment.
23314411 results demonstrate that, during HIV infection, Tim-3 expression on innate cells is dysregulated and that this dysregulation is only partially restored after 6 months of cART; findings suggest Tim-3 is differentially regulated on innate immune effector cells
23291409 PD1 and TIM3 polymorphisms may differentially and interactively predispose cirrhosis and HCC in chronic HBV infection.
23180819 A potential pathway activated by Tim3/galectin 9 is the secretion of interleukin (IL)-1beta, which plays a crucial role in antimicrobial immunity by modulating innate inflammatory networks in patients with pulmonary tuberculosis.
23161469 HCV-infected human hepatocytes express higher levels of Gal-9 and TGF-beta, and upregulate Tim-3 expression.
23144609 This study therefore uncovered a previously unknown mechanism for T-cell immune responses regulated by Tim-3, and findings may have implications for potential immune intervention in TB.
23117395 a dysregulated Tim-3/Gal-9 pathway may contribute to the pathogenesis of ulcerative colitis
23029209 data suggest that Tim-3 upregulation was driven by both HIV-1 viral replication and increased age, whereas PD-1 expression is associated with immune activation
22968087 The polymorphisms of TIM-3 gene may not contribute to Grave's disease susceptibility in the Chinese Han population.
22875804 Mutation of Tim3 transgene results in decreased phosphorylation of the T cell receptor-CD3zeta-chain; mice with this Tim3 mutation infected with influenza are protected from morbidity and mortality without impairment in viral clearance.
22842346 TIM-3 circumvents the stimulatory effects of nucleic acids in tumor immunity by interactding with HMGB1 to interfere with the recruitment of nucleic acids into dendritic cell endosomes
22792231 Tim-3 negatively regulates cytotoxicity in exhausted CD8+ T cells in HIV infection.
22738814 Th17 cell differentiation, IL-17 levels, and TIM-3 regulation may be involved in the pathogenesis of GBS.
22733499 the correlation of TIM-3 polymorphisms with susceptibility to pancreatic cancer in the Chinese population
22587604 -1516G/T polymorphism in the promoter region of TIM3 gene may affect the disease susceptibility and hepatocellular carcinoma traits associated with chronic hepatitis B virus infection infection.
22539292 It was shown that Tim-3 negatively regulates antiviral responses of CD8+ T cells isolated from chronic hepatitis B patients, and this response is reversed by blocking the Tim-3 pathway.
22505239 The Tim-3/galectin-9 signaling pathway mediates T-cell senescence in Hepatitis B Virus-associated Hepatocellular Carcinoma.
22472081 polymorphisms in the TIM-3 gene are new risk factors for RCC
22469568 concluded that pro-apoptotic effects on Th1 population through galectin-9-Tim-3 pathway and the up-regulation of Tim-2 on Th2 cells might be critical to Th2-biased response of host with schistosomiasis japonica.
22426209 Long-term exposure of CD4+ T cells to IL-12 caused T cell dysfunction & induced TIM-3. TIM-3 was required for this negative effect. TIM-3 was highly expressed on functionally impaired intratumoral T cells.
22387059 data provide evidence that augmented Tim-3 expression on natural killer (NK) cells plays an important role in NK cell loss in atherosclerosis
22383801 Findings suggest that natural killer-cell responses may be negatively regulated when NK cells encounter target cells expressing cognate ligands of Tim-3.
22371007 Reduced levels of Tim-3 on CD4(pos) CD25(neg) effector cells and of Gal9 in T-regs contribute to impaired immunoregulation in autoimmune hepatitis by rendering effector cells less prone to T-reg control and T-regs less capable of suppressing.
22363469 This study reveals a new role of TIM-3 as an important immune regulator in the tumor microenvironment via its predominant expression in regulatory T cells.
22323453 Tim-3 functions as a human NK-cell coreceptor to enhance IFN-gamma production, which has important implications for control of infectious disease and cancer.
22294262 Impaired Tim-3 expression allows Th17, Th1 and Tc1 cells to escape from Tim-3-mediated negative regulatory systems and may contribute to the pathogenesis of psoriasis.
22177036 There is no correlation between allergic rhinitis susceptibility and Tim-3 gene polymorphism in Uigur and Han people in Xinjiang.
22172823 TIM-3 mRNA quantification by RT-PCR in peripheral blood leukocytes may be a promising tool for a noninvasive diagnosis of acute rejection in renal graft recipients.
21989170 Genetic variations of TIM-3 gene contribute to rheumatoid arthritis susceptibility among different populations.
21844165 Blocking Tim-3 increases TLR-mediated IL-12 production & decreases activation-induced up-regulation of the immunoinhibitor, PD-1. TNF-alpha production is not altered significantly, but IL-10 production was increased.
21807895 Data suggest that ectopic expression of Tim-3 in T cells leads to enhancement of T-cell receptor-dependent signaling pathways.
21717191 data suggest that TIM-3 and its interaction with Gal-9 may play an important role in the pathogenesis of RA and may represent a potential therapeutic target
21637332 Tim-3 is constitutively expressed on human resting CD14(+) monocyte/macrophages (M/M(O)) and functions as a cap to block IL-12.
21621846 results suggest the regulatory role of MEK in TIM-3 transcription by human CD4+ T cells and mast cells
21565238 T-cell immunoglobulin and mucin domain 3 genetic polymorphisms are associated with rheumatoid arthritis independent of a shared epitope status.
21519864 augmented expression of Tim-3 may play an important role in the pathogenesis of ischemic stroke by regulation of proinflammatory cytokines.
21446887 TIM-3 and its interaction with Gal-9 are closely associated with rheumatoid arthritis activity.
21402546 These data suggest that Tim-3 expression is reduced in human T-lymphotropic virus type I (HTLV-I) infection and that a high number of Tim-3(-) HTLV-I-specific cytotoxic T lymphocytes preserves their cytolytic activity.
21392402 Tim-3 expression on peripheral T cell subsets correlates with disease progression in hepatitis B infection.
21382414 The elevated expression of Tim-3 on CD8 T cells correlates with functional defects of CD8 T cells and disease severity of pulmonary TB.
21367814 The findings suggest that the polymorphisms of TIM gene family might not contribute to systemic lupus erythematosus susceptibility in the Chinese population.
21263071 Both TIM-3 and galectin-9 undergo rapid proteolytic degradation in the cystic fibrosis CF lung, primarily because of neutrophil elastase and proteinase-3 activity.
21084749 Blockade of either PD-1 or Tim-3 enhanced in vitro proliferation of HCV-specific CTLs to a similar extent, whereas cytotoxicity against a hepatocyte cell line that expressed cognate HCV epitopes was increased exclusively by Tim-3 blockade.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20819923 PD-1(+) NY-ESO-1-specific CD8(+) T cells in patients with advanced melanoma up-regulates Tim-3 expression
20811886 three genetic variations within the TIM-3 gene promoter may be associated with the increased susceptibility to gastric cancer, especially among the haplotypes with the risk.
20811886 Observational study of gene-disease association. (HuGE Navigator)
20805041 Tim-3 might participate in the pathogenesis of rheumatoid arthritis by its negative regulation on various T cell subsets.
20656318 Histiocytic and dendritic cell neoplasms consistently express TIM-3 and TIM-4 and that these molecules are new markers of neoplasms derived from histiocytic and dendritic cells.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20574007 The Tim-3/galectin-9 pathway regulates T helper cell type (Th)1 immune responses through at least two mechanisms: directly, by triggering cell death in Th1 cells and indirectly, through the expansion of suppressive CD11b+Ly6G+ cells.
20503287 Observational study of gene-disease association. (HuGE Navigator)
20331378 Observational study of gene-disease association. (HuGE Navigator)
20176801 Mucin domain-containing molecule 3 (Tim-3) is preferentially expressed in lymphoma-derived endothelial cells.
20133006 Hepatitis B virus infection can up-regulate Tim-3 expression in natural killer cells (NK), which may in turn suppress NK-cell functions in chronic hepatitis B patients.
20083673 Structural and biologic studies reveal that TIM-3 is a receptor for phosphatidylserine (PtdSer) and that TIM-3 polymorphic variants differ functionally in their recognition of PtdSer and clearance of apoptotic cells.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19789190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19768575 The TIM-3 pathway and the therapeutic potential of modulating the pathway in systemic lupus erythematosus, is reviewed.
19676072 These results suggest that TIM-3 is a negative regulator of human T cells and regulates Th1 and Th17 cytokine secretion.
19587053 Tim-3 expression correlates with a dysfunctional and senescent phenotype (CD127(low) CD57(high)), a central rather than effector memory profile (CD45RA(negative) CCR7(high)), and reduced Th1/Tc1 cytokine production.
19566956 These data suggest that polymorphisms in the TIM3 promoter region are unlikely to play an important role in susceptibility to allergic diseases
19494522 haplotypes including TIM-3 genetic variants confer susceptibility to asthma in a Chinese population
19494522 Observational study of gene-disease association. (HuGE Navigator)
19480659 Reduced TIM-3 expression in the lungs of patients may result in a defective T cell ability to control the Th1 immune response and could thus contribute to the pathogenesis of sarcoidosis.
19414817 Tim-3, by virtue of its up-regulation in innate immune cells in pregnant women, enhances both innate and adaptive immune responses
19395088 expression is increased on Vdelta T cells of pregnant women
19332093 The -1516G>T, -574T>G, and 4259G>T of TIM-3 gene polymorphisms might not play an important role as a genetic risk factor in the pathophysiology of ITP.
19332093 Observational study of gene-disease association. (HuGE Navigator)
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19104436 Tim-3 messenger RNA evaluation in renal transplant recipients is a noninvasive method to evaluate graft dysfunction.
19100864 The simultaneous expression of galectin-9 and Tim-3 may indicate an immunoregulatory function, during the ongoing cytotoxic response.
19005181 Nasopharyngeal carcinoma exosomes induce massive apoptosis in EBV-specific CD4(+) cells used as a model of target T cells. This effect is inhibited by both anti-Tim-3 and antigalectin-9 blocking antibodies.
19001139 Data show that blockade of the Tim-3 pathway can enhance HIV-1 - specific T cell responses, and suggest that the Tim-3 pathway plays a critical role in suppressing the overall T cell response to HIV-1.
18785518 strong linkage disequilibrium between the two SNPs sites in the TIM-3 gene in a Han population from Hubei province
18785518 Observational study of gene-disease association. (HuGE Navigator)
18485114 increase of TIM-3 expression on PBMCs, overproduction of IFN-gamma in the sera, and increased galectin-9 in PBMCs was observed in acquired aplastic anemia patients
18401547 role of the rs10515746 (A/C), rs1036199 (A/C), and rs10053538 (A/C) SNPs within the TIM-3 gene in 186 German type 1 diabetes families and its interaction with human leukocyte antigen (HLA) high-risk haplotypes
18401547 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18354161 multiple sclerosis may function in part by restoring TIM-3 immunoregulation of T cell function
18294362 Observational study of gene-disease association. (HuGE Navigator)
18052965 Involved in the pathogenesis of systemic lupus erythematosus.
18006747 data show that Tim-3 is highly expressed by cells of the innate immune system and that its expression on antigen-presenting cells promotes the secretion of proinflammatory cytokines from monocytes and dendritic cells
17703412 Observational study of gene-disease association. (HuGE Navigator)
17665973 T-cell immunoglobulin- and mucin-domain-containing molecule-3 (Tim-3) influences autoimmune diseases, and its role in other inflammatory diseases including allergies and cancer is becoming clear.
17430399 High expressionof TIM-3 in in acute kidney transplant rejection makes it a promising noninvasive test for its diagnosis.
17096021 Expressed in melanoma cell lines at higher level than in isolated epidermal melanocytes, which can contribute to lower adhering capacity of tumor cells. TIM-3 in TGF-beta-stimulated mast cells and melanoma cells may support survival of this tumor type.
17069754 Stimulation of Tim-3 by its ligand galectin-9 results in increased phosphorylation of Y265, suggesting that this tyrosine residue plays an important role in downstream signalling events regulating T-cell fate.
16940744 Observational study of gene-disease association. (HuGE Navigator)
16754722 Failure to up-regulate T cell expression of TIM3 in inflammatory sites may represent a novel, intrinsic defect that contributes to the pathogenesis of multiple sclerosis and other human autoimmune diseases.
16685421 Human Tim-3 can promote HAV entry into target cells but itself may not function as a cellular receptor of HAV.
16456792 Observational study of gene-disease association. (HuGE Navigator)
16159638 Observational study of gene-disease association. (HuGE Navigator)
15867855 Observational study of gene-disease association. (HuGE Navigator)
15603868 Observational study of gene-disease association. (HuGE Navigator)
15603868 the -574T > G polymorphism of Tim-3 might be associated with the susceptibility of atopic diseases
15325803 Observational study of gene-disease association. (HuGE Navigator)
15325803 Tim-3 gene associated with rheumatoid arthritis

AA Sequence

MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVVLRT      1 - 70
DERDVNYWTSRYWLNGDFRKGDVSLTIENVTLADSGIYCCRIQIPGIMNDEKFNLKLVIKPAKVTPAPTR     71 - 140
QRDFTAAFPRMLTTRGHGPAETQTLGSLPDINLTQISTLANELRDSRLANDLRDSGATIRIGIYIGAGIC    141 - 210
AGLALALIFGALIFKWYSHSKEKIQNLSLISLANLPPSGLANAVAEGIRSEENIYTIEENVYEVEEPNEY    211 - 280
YCYVSSRQQPSQPLGCRFAMP                                                     281 - 301
//

Text Mined References (192)

PMID Year Title
27049082 Decreased serum levels of T-cell immunoglobulin mucin-1 and T-cell immunoglobulin mucin-3 in systemic lupus erythematosus patients.
26930930 2015 [Expression of Tim-3 on peripheral blood CD4+ T cells and its correlation with liver function damage parameters in advanced schistosomiasis patients].
26492563 2015 TIM-3 Suppresses Anti-CD3/CD28-Induced TCR Activation and IL-2 Expression through the NFAT Signaling Pathway.
26464703 2015 Expression of Tim-3 in gastric cancer tissue and its relationship with prognosis.
26463635 2015 Prognostic value of PD-1 and TIM-3 on CD3+ T cells from diffuse large B-cell lymphoma.
26428847 2015 Increased Tim-3 expression in peripheral NK cells predicts a poorer prognosis and Tim-3 blockade improves NK cell-mediated cytotoxicity in human lung adenocarcinoma.
26413815 2015 Differential expression and biochemical activity of the immune receptor Tim-3 in healthy and malignant human myeloid cells.
26401029 2016 Enhanced Expression of T-Cell Immunoglobulin and Mucin Domain Protein 3 in Endothelial Cells Facilitates Intracellular Killing of Rickettsia heilongjiangensis.
26373631 2015 Plasma soluble Tim-3 emerges as an inhibitor in sepsis: sepsis contrary to membrane Tim-3 on monocytes.
26342682 2015 Upregulation of the Tim-3/Gal-9 pathway and correlation with the development of preeclampsia.
26339368 2015 Up-regulation of Tim-3 is associated with poor prognosis of patients with colon cancer.
26279267 2015 A TIM-3/Gal-9 Autocrine Stimulatory Loop Drives Self-Renewal of Human Myeloid Leukemia Stem Cells and Leukemic Progression.
26265374 2015 T-cell immunoglobulin mucin-3 expression in bladder urothelial carcinoma: Clinicopathologic correlations and association with survival.
26239720 2015 Expression of immune checkpoint molecules of T cell immunoglobulin and mucin protein 3/galectin-9 for NK cell suppression in human gastrointestinal stromal tumors.
26215444 2015 Roles of the programmed cell death 1, T cell immunoglobulin mucin-3, and cluster of differentiation 288 pathways in the low reactivity of invariant natural killer T cells after chronic hepatitis B virus infection.
26214042 2015 The Clinical Significance of Abnormal Tim-3 Expression on NK Cells from Patients with Gastric Cancer.
26141233 2015 IL-15 induces strong but short-lived tumor-infiltrating CD8 T cell responses through the regulation of Tim-3 in breast cancer.
26125859 2015 Decreased TIM-3 mRNA expression in peripheral blood mononuclear cells from nephropathy patients.
26076826 2015 Increased Tim-3 expression on peripheral T lymphocyte subsets and association with higher disease activity in systemic lupus erythematosus.
26062425 2015 [Up-regulation of TIM-3 on CD4+ tumor infiltrating lymphocytes predicts poor prognosis in human non-small-cell lung cancer].
26008981 2015 Circulating and tumor-infiltrating Tim-3 in patients with colorectal cancer.
25950468 2015 PD-1 and Tim-3 pathways are associated with regulatory CD8+ T-cell function in decidua and maintenance of normal pregnancy.
25937557 2015 TIM-3 Genetic Variations Affect Susceptibility to Osteoarthritis by Interfering with Interferon Gamma in CD4+ T Cells.
25876049 2015 T-cell immunoglobulin domain and mucin domain 3 polymorphism affects cytokine expression in different cells and is associated with increased susceptibility to knee osteoarthritis.
25797693 2015 Hepatitis C viral infection is associated with activated cytolytic natural killer cells expressing high levels of T cell immunoglobulin- and mucin-domain-containing molecule-3.
25784621 2015 Participation of T cell immunoglobulin and mucin domain-3 (TIM-3) and its ligand (galectin-9) in the pathogenesis of active generalized vitiligo.
25772938 2015 MicroRNA-155 regulates interferon-? production in natural killer cells via Tim-3 signalling in chronic hepatitis C virus infection.
25685816 2015 Elevation of Tim-3 and PD-1 expression on T cells appears early in HIV infection, and differential Tim-3 and PD-1 expression patterns can be induced by common ? -chain cytokines.
25609823 2015 Soluble T cell immunoglobulin mucin domain 3 is shed from CD8+ T cells by the sheddase ADAM10, is increased in plasma during untreated HIV infection, and correlates with HIV disease progression.
25578313 2016 The Galectin-9/Tim-3 pathway is involved in the regulation of NK cell function at the maternal-fetal interface in early pregnancy.
25520133 2014 Tim-3 expression by peripheral natural killer cells and natural killer T cells increases in patients with lung cancer--reduction after surgical resection.
25483439 2015 The immune receptor Tim-3 mediates activation of PI3 kinase/mTOR and HIF-1 pathways in human myeloid leukaemia cells.
25400771 2014 Tim-3 is highly expressed in T cells in acute myeloid leukemia and associated with clinicopathological prognostic stratification.
25375372 2014 Tumor-induced senescent T cells promote the secretion of pro-inflammatory cytokines and angiogenic factors by human monocytes/macrophages through a mechanism that involves Tim-3 and CD40L.
25363763 2015 CEACAM1 regulates TIM-3-mediated tolerance and exhaustion.
25348621 2014 Expansion of dysfunctional Tim-3-expressing effector memory CD8+ T cells during simian immunodeficiency virus infection in rhesus macaques.
25342285 2015 Downregulation of T cell immunoglobulin and mucin protein 3 in the pathogenesis of intracranial aneurysm.
25220367 2015 Expression of coinhibitory receptors on T cells in the microenvironment of usual vulvar intraepithelial neoplasia is related to proinflammatory effector T cells and an increased recurrence-free survival.
25180498 2014 A regulatory polymorphism in HAVCR2 modulates susceptibility to HIV-1 infection.
25136083 2014 TIM-family proteins inhibit HIV-1 release.
25135732 2014 Up-regulated expression of Tim-3/Gal-9 at maternal-fetal interface in pregnant woman with recurrent spontaneous abortion.
25119597 2014 Analysis of Tim-3 as a therapeutic target in prostate cancer.
25091272 2014 A role for the TIM-3/GAL-9/BAT3 pathway in determining the clinical phenotype of multiple sclerosis.
24905803 2014 Tim-3 polymorphism downregulates gene expression and is involved in the susceptibility to ankylosing spondylitis.
24867713 2014 Association of T-cell immunoglobulin and mucin domain-containing molecule 3 (Tim-3) polymorphisms with susceptibility and disease progression of HBV infection.
24855276 2014 RepSox slows decay of CD34+ acute myeloid leukemia cells and decreases T cell immunoglobulin mucin-3 expression.
24845464 2014 Expression of human T cell immunoglobulin domain and mucin-3 on kidney tissue from immunoglobulin A nephropathy patients.
24838857 2014 Enhanced suppressor function of TIM-3+ FoxP3+ regulatory T cells.
24833097 2014 Tim-3 expression is increased on peripheral T cells from diffuse large B cell lymphoma.
24825777 2014 Regulation of T cell responses by the receptor molecule Tim-3.
24702227 2014 Increased expression of Dec-205, Bcl-10, Tim-3, and Trem-1 mRNA in chronic otitis media with cholesteatoma.
24689929 2014 Expression of TIM-3 on CD4+ and CD8+ T cells in the peripheral blood and synovial fluid of rheumatoid arthritis.
24651720 2014 Peripheral blood TIM-3 positive NK and CD8+ T cells throughout pregnancy: TIM-3/galectin-9 interaction and its possible role during pregnancy.
24642562 2014 Increased frequency of Tim-3 expressing T cells is associated with symptomatic West Nile virus infection.
24639110 2014 Hypothesis: Tim-3/galectin-9, a new pathway for leukemia stem cells survival by promoting expansion of myeloid-derived suppressor cells and differentiating into tumor-associated macrophages.
24512143 2014 Tim-3 on peripheral CD4? and CD8? T cells is involved in the development of glioma.
24498204 2014 Enhanced virus-specific CD8+ T cell responses by Listeria monocytogenes-infected dendritic cells in the context of Tim-3 blockade.
24477913 2014 Galectin-9 signaling through TIM-3 is involved in neutrophil-mediated Gram-negative bacterial killing: an effect abrogated within the cystic fibrosis lung.
24412470 2014 Imbalanced expression of human Tim-1 and Tim-3 in peripheral blood mononuclear cells from immune thrombocytopenia patients.
24339967 2013 Decreased galectin-9 and increased Tim-3 expression are related to poor prognosis in gastric cancer.
24337741 2014 T cell Ig and mucin domain-containing protein 3 is recruited to the immune synapse, disrupts stable synapse formation, and associates with receptor phosphatases.
24253699 2014 Expression of human T cell immunoglobulin domain and mucin-3 (TIM-3) on kidney tissue from systemic lupus erythematosus (SLE) patients.
24231118 2014 Decreased Tim-3 and its correlation with Th1 cells in patients with immune thrombocytopenia.
24209883 2013 The relationship between polymorphisms in the promoter region of Tim-3 and unexplained recurrent spontaneous abortion in Han Chinese women.
24195506 2014 Prognostic implication of TIM-3 in clear cell renal cell carcinoma.
24121505 2013 A disintegrin and metalloprotease (ADAM) 10 and ADAM17 are major sheddases of T cell immunoglobulin and mucin domain 3 (Tim-3).
24083425 2013 Age-dependent changes in the expression of regulatory cell surface ligands in activated human T-cells.
24007284 2013 The expression of Tim-3 in peripheral blood of ovarian cancer.
23967307 2013 Cis association of galectin-9 with Tim-3 differentially regulates IL-12/IL-23 expressions in monocytes via TLR signaling.
23936526 2013 Involvement of Galectin-9/TIM-3 pathway in the systemic inflammatory response in early-onset preeclampsia.
23922299 2013 Merkel polyomavirus-specific T cells fluctuate with merkel cell carcinoma burden and express therapeutically targetable PD-1 and Tim-3 exhaustion markers.
23886204 2013 Prognostic value of T cell immunoglobulin mucin-3 in prostate cancer.
23866914 2013 Dysregulated Tim-3 expression on natural killer cells is associated with increased Galectin-9 levels in HIV-1 infection.
23837986 2013 [Expression and significance of Tim-3 on peripheral blood monocytes in patients with chronic hepatitis B].
23791624 2013 A novel soluble form of Tim-3 associated with severe graft-versus-host disease.
23773130 2013 Characteristics of splenic CD8+ T cell exhaustion in patients with hepatitis C.
23665438 2013 Dysregulated expression of T cell immunoglobulin and mucin domain 3 is associated with the disease severity and the outcome of patients with spontaneous intracerebral hemorrhage.
23555261 2013 TIM-3 does not act as a receptor for galectin-9.
23555248 2013 TIM-family proteins promote infection of multiple enveloped viruses through virion-associated phosphatidylserine.
23526963 2013 Tim-3 expression defines regulatory T cells in human tumors.
23505323 2013 Genomic study in Mexicans identifies a new locus for triglycerides and refines European lipid loci.
23388728 2013 Differential regulation of interleukin-12 (IL-12)/IL-23 by Tim-3 drives T(H)17 cell development during hepatitis C virus infection.
23385979 2013 T-cell immunoglobulin- and mucin-domain-containing molecule 3 genetic variants and HIV+ non-Hodgkin lymphomas.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23365080 2013 T cell Ig mucin-3 promotes homeostasis of sepsis by negatively regulating the TLR response.
23359271 2013 T-cell immunoglobulin- and mucin-domain-containing molecule 3 gene polymorphisms and prognosis of non-small-cell lung cancer.
23335978 2013 Tim-3 expression in cervical cancer promotes tumor metastasis.
23334427 2013 Imbalanced expression of T-bet and T cell immunoglobulin mucin-3 in patients with aplastic anaemia.
23314411 2013 HIV infection deregulates Tim-3 expression on innate cells: combination antiretroviral therapy results in partial restoration.
23291409 2013 Genetic variations of PD1 and TIM3 are differentially and interactively associated with the development of cirrhosis and HCC in patients with chronic HBV infection.
23180819 2012 The Tim3-galectin 9 pathway induces antibacterial activity in human macrophages infected with Mycobacterium tuberculosis.
23161469 2013 HCV-infected hepatocytes drive CD4+ CD25+ Foxp3+ regulatory T-cell development through the Tim-3/Gal-9 pathway.
23144609 2012 Tim-3-expressing CD4+ and CD8+ T cells in human tuberculosis (TB) exhibit polarized effector memory phenotypes and stronger anti-TB effector functions.
23117395 2012 Dysregulated Tim-3 expression and its correlation with imbalanced CD4 helper T cell function in ulcerative colitis.
23029209 2012 Age-related expansion of Tim-3 expressing T cells in vertically HIV-1 infected children.
22968087 2012 Polymorphisms of the T-cell immunoglobulin and mucin domain molecule-3 are not associated with autoimmune Graves' disease in a Chinese Han Population.
22875804 2012 Enhanced Tim3 activity improves survival after influenza infection.
22842346 2012 Tumor-infiltrating DCs suppress nucleic acid-mediated innate immune responses through interactions between the receptor TIM-3 and the alarmin HMGB1.
22792231 2012 Tim-3 negatively regulates cytotoxicity in exhausted CD8+ T cells in HIV infection.
22738814 2012 Th17 helper cell and T-cell immunoglobulin and mucin domain 3 involvement in Guillain-Barré syndrome.
22733499 2012 T cell immunoglobulin- and mucin-domain-containing molecule 3 gene polymorphisms and susceptibility to pancreatic cancer.
22587604 2012 TIM3 gene polymorphisms in patients with chronic hepatitis B virus infection: impact on disease susceptibility and hepatocellular carcinoma traits.
22539292 2012 Blockade of Tim-3 signaling restores the virus-specific CD8? T-cell response in patients with chronic hepatitis B.
22505239 2012 Tim-3/galectin-9 signaling pathway mediates T-cell dysfunction and predicts poor prognosis in patients with hepatitis B virus-associated hepatocellular carcinoma.
22472081 2012 T-cell immunoglobulin- and mucin-domain-containing molecule 3 gene polymorphisms and renal cell carcinoma.
22469568 2012 Tim-2 up-regulation and galectin-9-Tim-3 pathway activation in Th2-biased response in Schistosoma japonicum infection in mice.
22426209 2012 IL-12 upregulates TIM-3 expression and induces T cell exhaustion in patients with follicular B cell non-Hodgkin lymphoma.
22387059 2012 Increased expression of T cell immunoglobulin- and mucin domain-containing molecule-3 on natural killer cells in atherogenesis.
22383801 2012 Tim-3 marks human natural killer cell maturation and suppresses cell-mediated cytotoxicity.
22371007 2012 The impaired immune regulation of autoimmune hepatitis is linked to a defective galectin-9/tim-3 pathway.
22363469 2012 TIM-3 expression characterizes regulatory T cells in tumor tissues and is associated with lung cancer progression.
22323453 2012 Tim-3 is an inducible human natural killer cell receptor that enhances interferon gamma production in response to galectin-9.
22294262 2012 Impaired expression of Tim-3 on Th17 and Th1 cells in psoriasis.
22177036 2011 [Relationship between polymorphism sites of Tim-3 and allergic rhinitis in a population of Uigurs and Hans from Xinjiang Uigur Autonomous Region of China].
22172823 2011 Sequential monitoring of TIM-3 gene expression in peripheral blood for diagnostic and prognostic evaluation of acute rejection in renal graft recipients.
22171320 2012 Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD.
21989170 2011 The -1541 C>T and +4259 G>T of TIM-3 polymorphisms are associated with rheumatoid arthritis susceptibility in a Chinese Hui population.
21844165 2012 Tim-3 regulates pro- and anti-inflammatory cytokine expression in human CD14+ monocytes.
21807895 2011 Phosphotyrosine-dependent coupling of Tim-3 to T-cell receptor signaling pathways.
21717191 2012 Underexpression of TIM-3 and blunted galectin-9-induced apoptosis of CD4+ T cells in rheumatoid arthritis.
21637332 2011 Tim-3 negatively regulates IL-12 expression by monocytes in HCV infection.
21621846 2011 Activation of mitogen activated protein kinase-Erk kinase (MEK) increases T cell immunoglobulin mucin domain-3 (TIM-3) transcription in human T lymphocytes and a human mast cell line.
21565238 2011 T-cell immunoglobulin and mucin domain 3 genetic polymorphisms are associated with rheumatoid arthritis independent of a shared epitope status.
21519864 2011 Increased T cell immunoglobulin and mucin domain 3 positively correlate with systemic IL-17 and TNF-? level in the acute phase of ischemic stroke.
21446887 2011 Expression of human TIM-3 and its correlation with disease activity in rheumatoid arthritis.
21402546 2011 Reduced Tim-3 expression on human T-lymphotropic virus type I (HTLV-I) Tax-specific cytotoxic T lymphocytes in HTLV-I infection.
21392402 2011 Tim-3 expression on peripheral T cell subsets correlates with disease progression in hepatitis B infection.
21382414 2011 Elevated expression of Tim-3 on CD8 T cells correlates with disease severity of pulmonary tuberculosis.
21367814 2011 Polymorphisms of the TIM-1 and TIM-3 genes are not associated with systemic lupus erythematosus in a Chinese population.
21263071 2011 Dysregulation of TIM-3-galectin-9 pathway in the cystic fibrosis airways.
21084749 2010 Tim-3 expression on PD-1+ HCV-specific human CTLs is associated with viral persistence, and its blockade restores hepatocyte-directed in vitro cytotoxicity.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20819923 2010 Upregulation of Tim-3 and PD-1 expression is associated with tumor antigen-specific CD8+ T cell dysfunction in melanoma patients.
20811886 2010 Genetic variations and haplotypes in TIM-3 gene and the risk of gastric cancer.
20805041 2010 Increased Tim-3 expression on peripheral lymphocytes from patients with rheumatoid arthritis negatively correlates with disease activity.
20656318 2010 The phosphatidylserine receptors, T cell immunoglobulin mucin proteins 3 and 4, are markers of histiocytic sarcoma and other histiocytic and dendritic cell neoplasms.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20574007 2010 Tim-3/galectin-9 pathway: regulation of Th1 immunity through promotion of CD11b+Ly-6G+ myeloid cells.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
20176801 2010 Lymphoma endothelium preferentially expresses Tim-3 and facilitates the progression of lymphoma by mediating immune evasion.
20133006 2010 T cell immunoglobulin- and mucin-domain-containing molecule-3 (Tim-3) mediates natural killer cell suppression in chronic hepatitis B.
20083673 2010 T cell/transmembrane, Ig, and mucin-3 allelic variants differentially recognize phosphatidylserine and mediate phagocytosis of apoptotic cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19789190 2009 A gene-based risk score for lung cancer susceptibility in smokers and ex-smokers.
19768575 2010 TIM-3 as a new therapeutic target in systemic lupus erythematosus.
19676072 2009 TIM-3 is expressed on activated human CD4+ T cells and regulates Th1 and Th17 cytokines.
19587053 2009 Negative immune regulator Tim-3 is overexpressed on T cells in hepatitis C virus infection and its blockade rescues dysfunctional CD4+ and CD8+ T cells.
19566956 2009 Lack of association of TIM3 polymorphisms and allergic phenotypes.
19494522 2009 Family-based association study of Tim-1 and Tim-3 gene polymorphisms with childhood asthma in Chinese trios.
19480659 2009 Altered expression of T cell immunoglobulin-mucin (TIM) molecules in bronchoalveolar lavage CD4+ T cells in sarcoidosis.
19414817 2009 Human pregnancy up-regulates Tim-3 in innate immune cells for systemic immunity.
19395088 2009 Immunoactivation in preeclampsia: Vdelta2+ and regulatory T cells during the inflammatory stage of disease.
19332093 2009 The role of T-cell immunoglobulin- and mucin-domain-containing molecule-3 polymorphisms in idiopathic thrombocytopenic purpura.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19104436 2008 Noninvasive Tim-3 messenger RNA evaluation in renal transplant recipients with graft dysfunction.
19100864 2009 Detection of the Tim-3 ligand, galectin-9, inside the allograft during a rejection episode.
19005181 2009 Blood diffusion and Th1-suppressive effects of galectin-9-containing exosomes released by Epstein-Barr virus-infected nasopharyngeal carcinoma cells.
19001139 2008 Tim-3 expression defines a novel population of dysfunctional T cells with highly elevated frequencies in progressive HIV-1 infection.
18785518 2008 [The relationship between the haplotype of T cells immunoglobulin mucin-3 gene and allergic asthma in the Han population from Hubei province of China].
18485114 2008 Increased T cell immunoglobulin mucin-3 and its ligand in acquired aplastic anemia.
18401547 2008 TIM-3 polymorphisms in type 1 diabetes families.
18354161 2008 Lack of TIM-3 immunoregulation in multiple sclerosis.
18294362 2008 Significant association between TIM1 promoter polymorphisms and protection against cerebral malaria in Thailand.
18052965 2008 Expression of human TIM-1 and TIM-3 on lymphocytes from systemic lupus erythematosus patients.
18006747 2007 Promotion of tissue inflammation by the immune receptor Tim-3 expressed on innate immune cells.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17665973 2007 TIM-3 as a therapeutic target in human inflammatory diseases.
17430399 2007 High expression of Tim-3 mRNA in urinary cells from kidney transplant recipients with acute rejection.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17096021 2007 TIM-3 is expressed in melanoma cells and is upregulated in TGF-beta stimulated mast cells.
17069754 2006 A highly conserved tyrosine of Tim-3 is phosphorylated upon stimulation by its ligand galectin-9.
16940744 2006 Genetic association studies between the T cell immunoglobulin mucin (TIM) gene locus and childhood atopic dermatitis.
16754722 2006 Dysregulated T cell expression of TIM3 in multiple sclerosis.
16685421 2006 Human membrane protein Tim-3 facilitates hepatitis A virus entry into target cells.
16456792 2006 [Study on relationship between polymorphism sites of TIM-3 and allergic asthma in a population of adult Hans from Hubei province of China].
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16286920 2005 The Tim-3 ligand galectin-9 negatively regulates T helper type 1 immunity.
16159638 2005 Association of atopy and eczema with polymorphisms in T-cell immunoglobulin domain and mucin domain-IL-2-inducible T-cell kinase gene cluster in chromosome 5 q 33.
15867855 2005 Genetic variants of the T-cell immunoglobulin mucin 1 but not the T-cell immunoglobulin mucin 3 gene are associated with asthma in an African American population.
15603868 2004 The association of TIM-3 gene polymorphism with atopic disease in Korean population.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15325803 2004 The polymorphisms of Th1 cell surface gene Tim-3 are associated in a Korean population with rheumatoid arthritis.
15153541 2004 T Cell Ig- and mucin-domain-containing molecule-3 (TIM-3) and TIM-1 molecules are differentially expressed on human Th1 and Th2 cells and in cerebrospinal fluid-derived mononuclear cells in multiple sclerosis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14556006 2003 Interaction of Tim-3 and Tim-3 ligand regulates T helper type 1 responses and induction of peripheral tolerance.
14556005 2003 Tim-3 inhibits T helper type 1-mediated auto- and alloimmune responses and promotes immunological tolerance.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11823861 2002 Th1-specific cell surface protein Tim-3 regulates macrophage activation and severity of an autoimmune disease.
11725301 2001 Identification of Tapr (an airway hyperreactivity regulatory locus) and the linked Tim gene family.