Property Summary

NCBI Gene PubMed Count 19
PubMed Score 0.12
PubTator Score 0.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (10)

Disease log2 FC p
acute myeloid leukemia 2.200 4.8e-02
astrocytic glioma 1.800 1.2e-02
ependymoma 2.000 1.0e-02
Multiple myeloma -1.559 7.1e-03
oligodendroglioma 1.900 6.2e-03
osteosarcoma 2.167 4.0e-08
ovarian cancer -1.100 3.1e-03
pancreatic ductal adenocarcinoma liver m... 2.006 4.6e-03
Pick disease 1.200 9.4e-08
psoriasis 1.200 6.2e-04

AA Sequence

MAAANPWDPASAPNGAGLVLGHFIASGMVNQEMLNMSKKTVSCFVNFTRLQQITNIQAEIYQKNLEIELL      1 - 70
KLEKDTADVVHPFFLAQKCHTLQSMNNHLEAVLKEKRSLRQRLLKPMCQENLPIEAVYHRYMVHLLELAV     71 - 140
TFIERLETHLETIRNIPHLAANLKKMNQALAKMDILVTETEELAENILKWRKQQNEVSSCIPKILAEESY    141 - 210
LYKHDIIMPPLPFTSKVHVQTINAK                                                 211 - 235
//

Text Mined References (20)

PMID Year Title