Property Summary

NCBI Gene PubMed Count 34
PubMed Score 26.72
PubTator Score 137.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
osteosarcoma -5.608 1.7e-16
group 3 medulloblastoma 3.600 2.3e-05
atypical teratoid / rhabdoid tumor 2.200 7.1e-03
primitive neuroectodermal tumor 1.600 7.2e-03
Atopic dermatitis 2.500 3.1e-04
primary pancreatic ductal adenocarcinoma 1.473 9.3e-03
intraductal papillary-mucinous neoplasm ... 2.100 3.2e-04
pancreatic cancer 1.200 5.7e-03
interstitial cystitis -2.600 1.9e-04
cystic fibrosis 3.000 2.1e-05
psoriasis 2.900 1.4e-166
Breast cancer -3.700 2.7e-70
breast carcinoma -1.600 1.8e-14

Gene RIF (24)

PMID Text
26222208 Overexpression of HAS3 decreased ERK1/2 phosphorylation suggesting that inhibition of MAP-kinase signaling was responsible for decreased melanoma cell adhesion, migration and proliferation.
25934334 HAS3 underexpression is associated with advanced tumor stage and adverse pathological features, as well as implies inferior clinical outcomes for both groups of patients with UTUCs and UBUCs, suggesting its critical role in tumor progression
25843802 Transcriptional factor binding analysis indicated that HAS3 gene promoter lacks of canonical TATA box, but contains classical GC box as well as other putative binding sites for transcriptional factors
25147816 Hyaluronan accumulation by HAS3 favors pancreatic cancer growth.
24658508 HAS3 mRNA expression level increases in atopic dermatitis lesions compared with healthy and non-lesional skin
24509846 Rab10 silencing increased the plasma membrane residence of HAS3, resulting in a significant increase of hyaluronan secretion and an enlarged cell surface HA coat, whereas Rab10 overexpression suppressed hyaluronan synthesis.
24470002 Hyaluronan (HA) produced by HAS3 is a ubiquitous component of the extracellular matrix and plays an active role in tissue remodeling. In addition, HA is known to reduce reactive oxygen species (ROS) -induced cardiac injury.
23979132 Data indicate that oxLDL doubled the transcripts of hyaluronan synthases HAS2 and HAS3 and hyaluronan deposition via the scavenger receptor LOX-1.
23560496 Inverse expression of hyaluronidase 2 and hyaluronan synthases 1-3 is associated with reduced hyaluronan content in malignant cutaneous melanoma.
23303191 Hyaluronan synthase 1 (HAS1) requires higher cellular UDP-GlcNAc concentration than HAS2 and HAS3
22695958 HA chains synthesized by HAS1 and HAS2 contribute to outflow resistance, while hyaluronan produced by HAS3 does not appear to play a significant role.
21429221 Data show that mRNA of HAS isoform 3 (HAS3) was upregulated in ESCC biopsies.
20875124 Hyaluronan synthases (HAS1-3) and hyaluronidases (HYAL1-2) in the accumulation of hyaluronan in endometrioid endometrial carcinoma
20849445 Nodular basal cell carcinoma is associated with increased levels of hyaluronic acid concomitant with upregulation of gene expression of HAS3, HYAL3 and RHAMM, when compared with normal adjacent skin.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19435493 HAS1, HAS2 and HAS3 expression is not consistently elevated in ovarian carcinomas.
19231585 Hyaluronan synthase (HAS2 and HAS3) and hyaluronan may mediate cellular invasion via changes in MMP-7 expression in SW620 colon carcinoma cells.
18587729 Observational study of gene-disease association. (HuGE Navigator)
16786194 The aim of this study was to evaluate how TNF-alpha, IFN-gamma,IL-1beta, and exposition to oxidative stress may modulate HAS activities in normal human skin fibroblasts.
16564133 mRNA for HAS1 is undetectable but HAS3 mRNA can be readily detected in freshly isolated CD133+ as well as in CD133- umbilical cord blood (UCB) cells. mRNA for HAS2 can only be detected in CD133+ progenitor cells.
14636845 Expression of each hyaluronan synthase isoform is regulated differently by growth factors and cytokines in vascular endothelial cells. Expressed in proliferative membranes from proliferative vitreoretinal diseases. May affect progression of diseases.
14566823 Hyaluronan and HAS3 function in the growth and progression of colon carcinoma
11790779 hyaluronan synthase expression in prostate adenocarcinoma cells

AA Sequence

MPVQLTTALRVVGTSLFALAVLGGILAAYVTGYQFIHTEKHYLSFGLYGAILGLHLLIQSLFAFLEHRRM      1 - 70
RRAGQALKLPSPRRGSVALCIAAYQEDPDYLRKCLRSAQRISFPDLKVVMVVDGNRQEDAYMLDIFHEVL     71 - 140
GGTEQAGFFVWRSNFHEAGEGETEASLQEGMDRVRDVVRASTFSCIMQKWGGKREVMYTAFKALGDSVDY    141 - 210
IQVCDSDTVLDPACTIEMLRVLEEDPQVGGVGGDVQILNKYDSWISFLSSVRYWMAFNVERACQSYFGCV    211 - 280
QCISGPLGMYRNSLLQQFLEDWYHQKFLGSKCSFGDDRHLTNRVLSLGYRTKYTARSKCLTETPTKYLRW    281 - 350
LNQQTRWSKSYFREWLYNSLWFHKHHLWMTYESVVTGFFPFFLIATVIQLFYRGRIWNILLFLLTVQLVG    351 - 420
IIKATYACFLRGNAEMIFMSLYSLLYMSSLLPAKIFAIATINKSGWGTSGRKTIVVNFIGLIPVSIWVAV    421 - 490
LLGGLAYTAYCQDLFSETELAFLVSGAILYGCYWVALLMLYLAIIARRCGKKPEQYSLAFAEV           491 - 553
//

Text Mined References (37)

PMID Year Title
26222208 2015 Hyaluronan synthase 3 (HAS3) overexpression downregulates MV3 melanoma cell proliferation, migration and adhesion.
25934334 2015 HAS3 underexpression as an indicator of poor prognosis in patients with urothelial carcinoma of the upper urinary tract and urinary bladder.
25843802 2015 Identification and analysis of the promoter region of the human HAS3 gene.
25147816 2014 Accumulation of extracellular hyaluronan by hyaluronan synthase 3 promotes tumor growth and modulates the pancreatic cancer microenvironment.
24658508 2014 Hyaluronan metabolism in human keratinocytes and atopic dermatitis skin is driven by a balance of hyaluronan synthases 1 and 3.
24509846 2014 Rab10-mediated endocytosis of the hyaluronan synthase HAS3 regulates hyaluronan synthesis and cell adhesion to collagen.
24470002 2014 Hyaluronan synthase 3 variant and anthracycline-related cardiomyopathy: a report from the children's oncology group.
23979132 2013 Oxidized low density lipoprotein (LDL) affects hyaluronan synthesis in human aortic smooth muscle cells.
23560496 2013 Inverse expression of hyaluronidase 2 and hyaluronan synthases 1-3 is associated with reduced hyaluronan content in malignant cutaneous melanoma.
23303191 2013 Hyaluronan synthase 1 (HAS1) requires higher cellular UDP-GlcNAc concentration than HAS2 and HAS3.
22695958 2012 Perturbation of hyaluronan synthesis in the trabecular meshwork and the effects on outflow facility.
21429221 2011 Inhibition of oesophageal squamous cell carcinoma progression by in vivo targeting of hyaluronan synthesis.
20875124 2010 Hyaluronan synthases (HAS1-3) and hyaluronidases (HYAL1-2) in the accumulation of hyaluronan in endometrioid endometrial carcinoma.
20849445 2011 Nodular basal cell carcinoma is associated with increased hyaluronan homeostasis.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19435493 2009 Expression of hyaluronan synthases (HAS1-3) and hyaluronidases (HYAL1-2) in serous ovarian carcinomas: inverse correlation between HYAL1 and hyaluronan content.
19231585 2009 Inhibition of hyaluronan synthases decreases matrix metalloproteinase-7 (MMP-7) expression and activity.
18821565 2008 Genome-wide association scan of quantitative traits for attention deficit hyperactivity disorder identifies novel associations and confirms candidate gene associations.
18587729 Further evidence for the association of MMP9 with nephropathy in type 2 diabetes and application of DNA pooling technology to candidate gene screening.
16900089 2006 Characterization of hyaluronan cable structure and function in renal proximal tubular epithelial cells.
16786194 2006 TNF-alpha, IFN-gamma, and IL-1beta modulate hyaluronan synthase expression in human skin fibroblasts: synergistic effect by concomital treatment with FeSO4 plus ascorbate.
16564133 2006 Expression of hyaluronan synthase genes in umbilical cord blood stem/progenitor cells.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14636845 Expression of hyaluronan synthase in intraocular proliferative diseases: regulation of expression in human vascular endothelial cells by transforming growth factor-beta.
14566823 2003 Hyaluronan synthase-3 is upregulated in metastatic colon carcinoma cells and manipulation of expression alters matrix retention and cellular growth.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11851874 2002 Hyaluronan synthase 3 regulates hyaluronan synthesis in cultured human keratinocytes.
11790779 2002 Manipulation of hyaluronan synthase expression in prostate adenocarcinoma cells alters pericellular matrix retention and adhesion to bone marrow endothelial cells.
11431361 2001 Hyaluronan synthase 3 overexpression promotes the growth of TSU prostate cancer cells.
11378333 2001 Up-regulation of putative hyaluronan synthase mRNA by basic fibroblast growth factor and insulin-like growth factor-1 in human skin fibroblasts.
11278609 2001 Hyaluronan synthase elevation in metastatic prostate carcinoma cells correlates with hyaluronan surface retention, a prerequisite for rapid adhesion to bone marrow endothelial cells.
10794710 2000 Expression of human hyaluronan synthases in response to external stimuli.
9169154 1997 Chromosomal localization of the human and mouse hyaluronan synthase genes.
9083017 1997 Molecular cloning and characterization of a cDNA encoding the third putative mammalian hyaluronan synthase.