Property Summary

NCBI Gene PubMed Count 15
PubMed Score 269.22
PubTator Score 45.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 1.300 1.4e-04
osteosarcoma -1.004 3.1e-04
ovarian cancer -1.100 2.7e-05

Protein-protein Interaction (3)

Gene RIF (5)

AA Sequence

MPLLGLLPRRAWASLLSQLLRPPCASCTGAVRCQSQVAEAVLTSQLKAHQEKPNFIIKTPKGTRDLSPQH      1 - 70
MVVREKILDLVISCFKRHGAKGMDTPAFELKETLTEKYGEDSGLMYDLKDQGGELLSLRYDLTVPFARYL     71 - 140
AMNKVKKMKRYHVGKVWRRESPTIVQGRYREFCQCDFDIAGQFDPMIPDAECLKIMCEILSGLQLGDFLI    141 - 210
KVNDRRIVDGMFAVCGVPESKFRAICSSIDKLDKMAWKDVRHEMVVKKGLAPEVADRIGDYVQCHGGVSL    211 - 280
VEQMFQDPRLSQNKQALEGLGDLKLLFEYLTLFGIADKISFDLSLARGLDYYTGVIYEAVLLQTPTQAGE    281 - 350
EPLNVGSVAAGGRYDGLVGMFDPKGHKVPCVGLSIGVERIFYIVEQRMKTKGEKVRTTETQVFVATPQKN    351 - 420
FLQERLKLIAELWDSGIKAEMLYKNNPKLLTQLHYCESTGIPLVVIIGEQELKEGVIKIRSVASREEVAI    421 - 490
KRENFVAEIQKRLSES                                                          491 - 506
//

Text Mined References (22)

PMID Year Title