Property Summary

Ligand Count 1
NCBI Gene PubMed Count 32
PubMed Score 66.84
PubTator Score 100.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count P-value
acute quadriplegic myopathy 1158 8.5e-09
ovarian cancer 8520 9.9e-06
Multiple myeloma 1332 3.0e-04
diabetes mellitus 1728 1.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Usher syndrome 32 0.0 5.0

Expression

  Differential Expression (4)

Disease log2 FC p
acute quadriplegic myopathy 1.299 8.5e-09
diabetes mellitus -1.200 1.1e-03
Multiple myeloma 1.738 3.0e-04
ovarian cancer -1.300 9.9e-06

Gene RIF (16)

AA Sequence

MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQM      1 - 70
AVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLA     71 - 140
MNKLTNIKRYHIAKVYRRDNPAMTRGRYREFYQCDFDIAGNFDPMIPDAECLKIMCEILSSLQIGDFLVK    141 - 210
VNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLV    211 - 280
EQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFGIDDKISFDLSLARGLDYYTGVIYEAVLLQTPAQAGEE    281 - 350
PLGVGSVAAGGRYDGLVGMFDPKGRKVPCVGLSIGVERIFSIVEQRLEALEEKIRTTETQVLVASAQKKL    351 - 420
LEERLKLVSELWDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVR    421 - 490
REDLVEEIKRRTGQPLCIC                                                       491 - 509
//

Text Mined References (35)

PMID Year Title