Property Summary

Ligand Count 9
NCBI Gene PubMed Count 16
PubMed Score 1057.27
PubTator Score 788.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Prostatic Neoplasms 495 0.0 0.0
Disease Target Count P-value
pancreatic ductal adenocarcinoma liver metastasis 1962 2.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Primary hyperoxaluria 15 4.056 2.0
diabetes mellitus 1728 3.189 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -2.643 2.6e-02

Gene RIF (5)

AA Sequence

MLPRLICINDYEQHAKSVLPKSIYDYYRSGANDEETLADNIAAFSRWKLYPRMLRNVAETDLSTSVLGQR      1 - 70
VSMPICVGATAMQRMAHVDGELATVRACQSLGTGMMLSSWATSSIEEVAEAGPEALRWLQLYIYKDREVT     71 - 140
KKLVRQAEKMGYKAIFVTVDTPYLGNRLDDVRNRFKLPPQLRMKNFETSTLSFSPEENFGDDSGLAAYVA    141 - 210
KAIDPSISWEDIKWLRRLTSLPIVAKGILRGDDAREAVKHGLNGILVSNHGARQLDGVPATIDVLPEIVE    211 - 280
AVEGKVEVFLDGGVRKGTDVLKALALGAKAVFVGRPIVWGLAFQGEKGVQDVLEILKEEFRLAMALSGCQ    281 - 350
NVKVIDKTLVRKNPLAVSKI                                                      351 - 370
//

Text Mined References (17)

PMID Year Title