1. Home
  2. Targets
  3. Hepcidin

Tbio Hepcidin

Has strong antimicrobial activity against E.coli ML35P N.cinerea and weaker against S.epidermidis, S.aureus and group b streptococcus bacteria. Active against the fungus C.albicans. No activity against P.aeruginosa (PubMed:11113131, PubMed:11034317).

The product encoded by this gene is involved in the maintenance of iron homeostasis, and it is necessary for the regulation of iron storage in macrophages, and for intestinal iron absorption. The preproprotein is post-translationally cleaved into mature peptides of 20, 22 and 25 amino acids, and these active peptides are rich in cysteines, which form intramolecular bonds that stabilize their beta-sheet structures. These peptides exhibit antimicrobial activity against bacteria and fungi. Mutations in this gene cause hemochromatosis type 2B, also known as juvenile hemochromatosis, a disease caused by severe iron overload that results in cardiomyopathy, cirrhosis, and endocrine failure. [provided by RefSeq, Oct 2014]

 Comments

Property Summary

NCBI Gene PubMed Count 336
PubMed Score 2012.87
PubTator Score 313.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Hemochromatosis 2B 1

Expression

  Differential Expression (6)

Disease log2 FC p
glioblastoma 2.700 2.5e-03
atypical teratoid / rhabdoid tumor -1.700 9.7e-04
medulloblastoma -1.800 1.2e-04
medulloblastoma, large-cell -1.700 4.7e-03
primitive neuroectodermal tumor -1.500 1.1e-02
cystic fibrosis -2.100 3.2e-04

Synonym

Accession P81172 Q1HE14 Q9BY68
Symbols HEPC
PLTR
HFE2B
LEAP1

Gene

HAMP

PDB

1M4E   1M4F   2KEF   3H0T   4QAE  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

 UniProt Keyword (13)

See all...

 GO Function (3)

 GO Component (5)

 GO Process (29)

See all...

 Compartment GO Term (24)

See all...

 OMIM Phenotype (1)

 MGI Phenotype (6)

 HCA RNA Cell Line (28)

See all...

Pathway (5)

Gene RIF (331)

PMID Text
27129231 TGF-beta1 may contribute to hepcidin synthesis during iron overload.
26981017 Studies indicate plasma and urine hepcidin as a marker of anemia of chronic disease and post-transplant anemia (PTA).
26866603 gonadotropin-stimulated endogenous estrogen markedly decreases circulating hepcidin-25 levels
26807955 Ceramide induced the binding of STAT3, but not NF-kappaB or c-Jun, to HAMP promoter.The mutation of STAT3 response element within 0.6 kb HAMP promoter region significantly inhibited the stimulatory effect of ceramide on HAMP promoter activity.
26582087 Identify 3 heterozygous missense mutations in BMP6 in patients with unexplained iron overload. These mutations lead to loss of signaling to SMAD proteins and reduced hepcidin production.
26515063 results clarify how commensal bacteria affect hepcidin expression and reveal a novel connection between IL-1beta and activation of BMP signaling.
26460251 erythropoietic drive, iron status, and inflammation all contribute to variation in hepcidin level.
26437604 The concentration of functional membrane-associated ferroportin is controlled by its ligand, the iron-regulatory hormone hepcidin, and fine-tuned by regulatory mechanisms serving iron homeostasis, oxygen utilization, host defense, and erythropoiesis.
26405701 Hepcidin levels are higher in NAFLD with iron overload.
26378394 Low hepcidin levels are associated with type 2 diabetes mellitus.
26310624 the effect of alpha-1-antitrypsin (A1AT) on the expression of the iron hormone hepcidin
26304124 lipids mediate post-transcriptional regulation of HAMP through PKC- and HuR-dependent mechanisms
26290281 The serum hepcidin, ferritin, alanine transaminase, aspartate transaminase, gamma-glutamyltransferase and bilirubin were examined in two independent Chinese cohorts consisted of 3455 individuals.
26270641 Parallel determination of liver hepcidin mRNA and serum hepcidin in patients with chronic liver diseases shows that circulating hepcidin and its respective ratio to ferritin are significantly diminished in patients with autoimmune liver diseases.
26252205 analysis of plasma hepcidin and anemia status in Zimbabwean infants, adjusted for sex, age and birthweight
26244503 At univariate logistic regression analysis, high pulse wave velocity was associated with higher ferritin levels (p=0.010), but lower hepcidin (p=0.045), and hepcidin ferritin/ratio (p<0.001).
26164540 Systemic inflammation and elevated values of IL-6 present in exacerbations and stabile chronic obstructive pulmonary disease might be responsible for the observed increased hepcidin level.
26137768 Iron overload and increased serum levels of hepcidin plays an important role in the pathogenesis of endometriosis.
26125411 TLR4 dependent macrophage signaling is controlled via hepcidin-ferroportin1 axis by influencing TLR4-lipid raft interactions
26118202 significant difference in serum levels according to time of day
26055723 Inflammation regulates hepcidin transcription, allowing for sufficient concentrations of iron for organismal needs while sequestering the metal from infectious pathogens. [Review]
25976966 Studies suggest that hepcidin may become a useful tool for diagnosis and management of iron disorders.
25976471 Single nucleotide polymorphisms in HAMP, BMP2, FTL and SLC40A1 genes have phenotype-modifying roles in hereditary hemochromatosis type 1.
25923089 Serum hepcidin levels correlate with insulin resistance and endocrine glands function in major thalassemia.
25907691 ferristatin II synergized with BMP6 and IL-6 to enhance hepcidin expression in vitro, However, this synergy was not due to activation of either Smad or Stat3 signaling
25896789 Abundant hepcidin protein found in brain parenchyma in the presence of levels of gene transcription that appear to be below the limits of detection is consistent with an origin for at least a proportion of hepcidin outside the brain
25894587 hepcidin-25 was associated with erythropoietin and impaired kidney function in diabetic chronic kidney disease.
25881778 Hepcidin levels are increased in acute ischemic stroke.
25858146 These results establish a new connection between iron metabolism and prostate cancer, and suggest that prostatic dysregulation of hepcidin contributes to prostate cancer growth and progression.
25816754 Peripheral expression of hepcidin was measured using quantitative real time PCR in 50 beta-thalassemia major patients, in addition to 20 healthy volunteers as a control group. Hepcidin levels in beta-thalassemia major patients showed statistically significant decrease in comparison to the control group, and was correlated to cardiac iron stores.
25805936 Decreased expression of hepcidin and ferroportin in hepatitis C patients indicates the importance of hepatocytic iron retention for viral response during pegylated-interferon plus ribavirin treatment.
25745821 Low hepcidin and high ferroportin expression by erythroblasts and macrophages were seen in iron deficiency anemia, while the opposite was true in anemia of chronic disorders.
25742771 liver congestion induces hepcidin production, which may result in anemia and functional iron deficiency in some patients with heart failure.
25635054 knockdown of CD81 did not affect the stimulation of hepcidin expression by BMP6 but increased both the expression of ID1 and SMAD7, direct targets of BMP signaling pathway, and the phosphorylation of ERK1/2
25633564 Data indicate that the hepcidin promoter bioassay system is useful for identifying and evaluating compounds that modulate hepcidin expression.
25598191 Hepcidin-25 shows a strong positive correlation with ferritin, and also correlates positively with CRP, in this patient population.
25553801 Elevated serum hepcidin levels are associated with the presence and severity of obstructive sleep apnea syndrome
25519750 Hepcidin is suppressed by erythropoiesis in hemoglobin E beta-thalassemia and beta-thalassemia trait.
25501198 hepcidin level is significantly increased in patients with chronic renal failure on maintenance hemodialysis.
25486930 Hereditary hypotransferrinemia caused by novel transferrin mutations can lead to elevated transferrin saturation and, when associated with HFE or HAMP mutations, to iron overload.
25465232 Serum hepcidin-25 levels are elevated in anemic Non-Hodgkin Lymphoma patients, and the group with higher hepcidin-25 levels manifested advanced anemia and poor survival.
25380934 hepcidin was significantly higher in heart allograft recipients compared with patients with chronic heart failure.
25363011 Mean prohepcidin levels were higher in premature newborns with oxygen radical diseases than in the control group.
25222239 Hepcidin level was significantly related to degree of anemia, indicating that an increase in hepcidin level will result in anemia.
25193892 In the absence of apparent inflammation, serum hepcidin levels correlated exclusively with ferritin levels in maintenance hemodialysis patients.
25176568 Chlorpyrifos inhibits hepatic hepcidin expression.
25134646 Significant differences were seen in the levels of serum iron and hepcidin but not ferritin between the -582A>G hepcidin polymorphism genotypes.
25115800 the effects of hepcidin expression and hepcidin peptide on brain iron contents, iron transport across the brain-blood barrier, iron uptake and release, and also the expression of TfR1, DMT1, and Fpn, were investigated.
25093806 combined data overall deciphered the machinery that altered the hepcidin-ferroportin signaling in breast cancers.
25065484 Circulating serum factors are involved in hypoxia-induced hepcidin suppression.
25052873 HAMP mRNA and GDF15 mRNA expression in peripheral blood mononuclear cells of multiple myeloma patients is up-regulated.
25015054 The hepcidin promoter TG haplotype, originated by linkage of the nc.-1010C > T and nc.-582A > G polymorphisms, is more common in the HFE_H63D patients with serum ferritin >300 mug/L than in those with normal serum ferritin levels or controls.
24988613 This review presents hepcidin structure, mechanism of action and regulation, and highlights hepcidin function in anaemia in inflammatory bowel disease.
24954786 Hepcidin is a promising serological marker for the differential diagnosis of tumor-related ACD and IDA, clarifying the pathogenesis of these anemias and guiding corrective treatment.
24946025 Elevated second trimester serum hepcidin levels were associated with a higher risk of adverse pregnancy outcomes and high third trimester hepcidin levels were associated with higher risk of neonatal complications.
24904118 results provide evidence that HFE induces hepcidin expression via the BMP pathway: HFE interacts with ALK3 to stabilize ALK3 protein and increase ALK3 expression at the cell surface.
24894955 The down-regulation of hepcidin expression leading to up-regulation of iron transporters expression in the duodenum seems to explain iron metabolism disturbances in alcoholic liver disease.
24875397 Polycystic ovary syndrome patients had iron excess and higher hepcidin levels, which are associated with metabolic derangements.
24718935 HCV core up-regulates HAMP gene transcription via a complex signaling network that requires both SMAD/BMP and STAT3 pathways and CK2 involvement
24667393 athlete's iron stores may dictate the baseline hepcidin levels and the magnitude of post-exercise hepcidin response
24599423 high circulating levels in abdominal aortic aneurysm
24596418 Irin status, erythropoietic drive, inflammation, and malaria season combine to control dynamic fluctuations of hepcidin in African children.
24589273 Studies indicate that hepcidin is the central hormonal regulator of iron metabolism.
24578220 UMCP-1 and hepcidin could be associated with the susceptibility of lupus nephritis.
24569625 Hepcidin levels are decreased independently from hs-CRP levels as a compensatory mechanism to increase the iron absorption in response to decreased serum iron levels in patients with RVD.
24533165 ceruloplasmin and hepcidin differentially regulate iron efflux from brain microvascular endothelial cells
24520384 IL-10 can directly regulate hepcidin in primary macrophages but not in HepG2 cells.
24507043 serum hepcidin correlates with hyperlipidemia status in allograft renal transplantation patients
24478088 These results support the key role of IL-6 in hepcidin regulation in response to a variety of infectious and inflammatory stimuli.
24387766 Data suggest that HAMP expression in hepatocytes can be regulated by dietary factors (here, down-regulation of HAMP promoter and HAMP expression by a hematinic dietary supplement, black soyabean seed coat extract).
24356769 Hepcidin levels are considerably elevated in dialysis patients, but obesity does not have an additional impact.
24341321 The lower serum and saliva prohepcidin and hepcidin concentrations found in recurrent aphthous stomatitis and Behcet's disease patients indicate that hepcidin may be involved in the aetiopathogenesis of these diseases.
24339866 Low hepcidin levels in severely anemic malawian children with high incidence of infectious diseases and bone marrow iron deficiency
24334869 Results suggest that the body iron distribution as determined by hepcidin affects the development of atherosclerosis in women.
24319154 Hepcidin insufficiency and increased iron absorption are also characteristic of anemia due to ineffective erythropoiesis in which, despite high total body iron, hepcidin is suppressed by the high erythropoietic activity
24306042 Plasma hepcidin-25 and ferritin light chain levels correlate with a malignant breast cancer diagnosis.
24252754 Study describes extensive blood vessel damage in Alzheimer's disease brain and a reduction in hepcidin and ferroportin levels
24244576 Iron metabolism is distorted in advanced HIV infection with CD4 cell counts correlating inversely with serum hepcidin levels.
24236640 ATOH8 is therefore a novel transcriptional regulator of HAMP, which is responsive to changes in plasma iron and erythroid activity
24204002 Direct transcriptional suppression of hepcidin gene (HAMP) expression mediated by 1,25-dihydroxyvitamin D binding to the vitamin D receptor causes decrease in hepcidin mRNA levels
24179092 FOG1, FOG2 and GATA-6 modulate the transcriptional up-regulation of HAMP in hepatocytes during inflammation.
24157792 these results indicate that a BMP or BMP-like molecule present in serum may play an important role in regulating hepcidin expression.
24119290 patients with chronic kidney disease on hemodialysis and peritoneal dialysis have higher serum concentrations of hepcidin than do healthy individuals
24014495 both serum concentration of pro-hepcidin and IL-1RN genotypes frequency reflect the disease activity, regardless of the anemia states in Rheumatoid arthritis (RA )patients, thus they may be another potential markers for disease activity of RA.
23905873 Data indicate that mean hepcidin (HAMP) mRNA levels in monocytes of splenectomized and non-splenectomized patients with thalassemia were 12.5 and 19.8 times, respectively, above those of normal controls.
23852902 pretransplant serum hepcidin-25 level is a useful indicator for predicting the risk of infection after transplantation
23846698 A model is proposed that suggests that unlike proteases, which are irreversibly bound to activated alpha2M, hepcidin remains labile and available to down-regulate Fpn1.
23842708 A dichotomized serum hepcidin level in myelodysplastic patients correlated with worse survival.
23836842 The study provides evidence for the existence of novel circulating hepcidin isoforms.
23798368 Data suggest that down-regulation of hepcidin-25 could be a diagnostic biomarker for anemia and up-regulation of hepcidin-25 could be a diagnostic biomarker for chronic kidney disease. [REVIEW]
23760782 Helicobacter pylori infection upregulates serum hepcidin levels and is associated with diminished response to oral iron therapy.
23700338 Caulis Spatholobi extract inhibits HAMP expression in Huh7 and HepG2 cells.
23665668 Hepcidin was found to be superior to C-reactive protein in predicting the severity of pancreatitis.
23656728 Hepcidin levels in patients with beta-thalassemia major dynamically reflect competing influences from erythropoiesis, anemia, and iron overload.
23647063 Findings suggest that elevated hepcidin levels and inadequate erythropoietin response are frequent in diffuse large B-cell lymphoma (DLBCL), but elevated interleukin-6 (IL-6) plays the major role for the development of anemia.
23618075 Hepcidin is classified as a type II acute phase protein; its production is a component of the innate immune response to infections. Hepcidin was found to rise during the acute infection and fall post-infection.
23580428 We have provided evidence that hepatitis C virus core+1/ARFP represses hepcidin promoter activity through the AP1 binding site, reducing hepcidin mRNA and protein levels.
23536837 the hormone hepcidin and its receptor ferroportin are internalized together and trafficked to lysosomes where both are degraded.
23531037 Hepcidin-25 is reabsorbed by the renal tubules and fractional excretion indicates local production of hepcidin-25.
23460869 Hepcidin regulatory pathways are already functional in infancy, but serum hepcidin alone may not clearly discriminate between iron-deficient anemic infants with and without infection.
23438894 These data suggest a critical role for PGC-1alpha in the regulation of hepatic HAMP expression and iron homeostasis under inflammatory circumstances.
23390933 Prohepcidin can bind to and transcriptionally regulate the expression of HAMP, suggesting a novel autoregulatory pathway of hepcidin gene expression in hepatocytes.
23390091 Among the PC family members, only furin activates hepcidin in hepatocytes, and uniquely the full-length membrane-bound PC7 can directly shed hTfR1 by cleavage at Arg100
23380741 Data indicate that circulatory hepcidin levels associated with the levels of its regulatory cytokine interleukin-6 and of the anti-inflammatory cytokine inerleukin-10 in childhood malaria.
23379486 Hepcidin is a key regulator of iron balance,and high serum hepcidin levels cause iron blockade and anemia in chronic kidney disease
23375327 Hemojuvelin and hepcidin affect iron metabolism and are elevated in kidney and heart allograft recipients
23335357 Data suggest that hepcidin, a major regulator of iron metabolism, is a biological marker for clinical assessment of patients with iron deficiency anemia; serum hepcidin level may predict response to oral iron therapy.
23314535 Monocytes and macrophages also express hepcidin, and in contrast to the liver, hepcidin expression is primarily regulated by inflammatory mediators and infectious agents.
23300182 MDS patients carrying a somatic mutation of SF3B1 have inappropriately low hepcidin levels which may cause excessive reticuloendothelial iron release and parenchymal iron loading.
23293962 HAI-2 is an inhibitor of matriptase-2 that modulates the synthesis of hepcidin.
23179904 Hepcidin expression in human hepatoma & leukemia cell lines was augmented by the acidic milieu created with lactic acid, hydrochloric acid & excess carbon dioxide.
23154866 In vitro studies showed a minimal upregulation of hepcidin mRNA in HepG2 cells treated with hereditary hemochromatosis patients' serum.
23148308 serum hepcidin level was elevated in seropositive and erosive Rheumatoid arthritis and was correlated with disease activity
23147161 High Hepcidin-25 expression is associated with cardiovascular events in chronic haemodialysis patients.
23144745 Data indicate that serum hepcidin levels increased significantly and linearly with increasing number of metabolic syndrome (MetS) feature.
23110054 Hepcidin can induce intracellular antiviral state while HCV has a strategy to suppress hepcidin expression.
23088733 Our findings highlight the potential usefulness of hepcidin measurement as a diagnostic tool.
23065513 ferroportin Q248H protein is resistant to physiological concentrations of hepcidin and that this mutation has discernible effects on iron metabolism-related clinical complications of sickle cell anemia.
23065507 older persons with anemia of inflammation have higher hepcidin levels than their counterparts without anemia.
23065424 Up-regulation of hepcidin during infection is thought to serve as a host defense strategy; data suggest that interleukin-6 down-regulates expression of hepcidin in hepatocytes.
23062413 Low preoperative hepcidin concentration might be a risk factor for in-hospital mortality after cardiac surgery.
23041085 estrogen greatly contributes to iron homeostasis by regulating hepatic hepcidin expression directly through a functional ERE in the promoter region of hepcidin gene
23012398 Letter: report mutations in HAMP promoter in and possible role in iron hemostasis in patients with porphyria cutanea tarda.
22951294 Serum levels of the hepcidin-20 isoform in a large general population
22932892 Physiological concentrations of hydrogen peroxide activate hepcidin transcription through signal transducer and activator of transcription 3 protein.
22869521 Proteasomal degradation of C/EBP alpha is necessary for hypoxia-inducible transcription factor - dependent hepcidin repression.
22851866 Analysis of hepcidin expression in hepatocellular carcinoma with in situ hybridization and quantitative polymerase chain reaction from paraffin sections
22844726 Based on the results of this small study, hepcidin was not associated with diabetic anemia
22819549 Glucose acts as a regulator of serum iron by increasing serum hepcidin concentrations.
22815544 Considerable variability of serum hepcidin levels in hemodialysis patients. Inflammation and the use of iron did not impact on the degree of variability, and hepcidin levels were higher after an inter-dialytic period of 3 versus 2 days.
22792339 Estrogen is involved in hepcidin expression via a GPR30-BMP6-dependent mechanism
22776295 labeled hepcidin was also a suitable tool to visualize internalization of overexpressed or even endogenously expressed ferroportin without tags
22768976 HCV positive HD patients have low levels of serum prohepcidin and IL-6 which might account for iron accumulation together with lower iron and rhuEPO requirements in these patients.
22689680 Hepcidin response to acute malaria supports the notion of iron sequestration during acute malaria infection and suggests that iron administration during acute malaria is futile.
22682227 ubiquitination is the functionally relevant signal for hepcidin-induced ferroportin endocytosis
22682226 Hepcidin-induced ferroportin internalization did not require JAK2 or phosphorylation of ferroportin residues 302 and 303
22676252 The hepcidin:ferritin ratio is reduced in relation to increasing fibrosis in chronic liver disease.
22611157 The signaling pathway responsible for hepcidin up-regulation in the inflammatory context is still not understood completely. Activin B has an unexpected but crucial role in the induction of hepcidin by inflammation.
22609894 In chronic heart failure patients without anemia, the inflammatory state (serum TNFR1) and deterioration in iron metabolism (serum hepcidin) were the main determinants of a decrease in hemoglobin.
22525500 NS5A inhibits the transcription of hepcidin mRNA and expression of hepcidin protein, inducing hepatic intracellular iron storage.
22398782 in chronic kidney disease patients sHJV levels correlated with serum hepcidin in univariate analysis but this was not evident in the multivariate analysis
22365732 Our findings suggest that hepcidin expression is controlled by body iron stores where soluble HJV and EPO may act as suppressors of hepcidin.
22249207 Ferroportin (SLC40A1) Q248H mutation is associated with lower circulating serum hepcidin levels in Rwandese HIV-positive women.
22248501 Data suggest that plasma level of hepcidin decreases with 8 weeks of endurance exercises; studies include effects of controlling training intensity, duration, and number of completed sessions.
22228627 Data show that the most consistent predictor of erythrocyte isotope incorporation was hepcidin.
22227182 Erythropoietin and vitamin C inhibited hepcidin expression within HepG2 cells.
22125467 Findings from this vein drainage study suggest there is no net release of hepcidin from the AbScAT depot and thereby no ability to signal systemically, even in obesity
22118000 serum hepcidin levels are associated with iron status and microinflammation in maintenance haemodialysis patients
22023767 serum ferritin levels below 30 microg/L indicate an asymptomatic iron deficiency status inhibiting hepcidin expression and that 30 microg/L should be considered the ferritin cut-off when considering an iron supplementation in young athletes.
21971825 GATA-RE, -TTATCT- in the HAMP promoter region -103/-98 is crucial for the GATA-4 and GATA-6 driven transcription of hepcidin in Huh7 cells.
21886780 Serum hepcidin was measured in 113 patients with different myelodysplastic Syndromes subtypes.
21885789 Elevated urinary hepcidin-25 1 day after cardiopulmonary bypass is a strong predictor of avoidance of acute kidney injury beyond postoperative day 1.
21882342 Hepcidin and iron mediated the resistance to malaria.
21876117 serum hepcidin concentration was correlated positively with serum ferritin concentration and negatively with homozygosity for VHL(R200W)
21873547 Data indicate that TMPRSS6 rs855791 has a functional role in determining protease activity and regulating hepcidin expression in normal subjects.
21873546 hepcidin induction represents a component of the innate immune response to acute infection, with the potential to affect disease pathogenesis.
21818622 The transitory increase and dynamics of its concentration make difficult the practical use of hepcidin to detect recombinant erythropoietin doping.
21810240 Airway epithelial cells express hepcidin in the lung in response to IFN-gamma.
21733041 Results suggest that following delivery, hepcidin serum levels increase.
21654163 Hepcidin-25 levels show correspondence in blood and urine; hepcidin-25 levels may be related to iron stores. Prohepcidin levels in blood and urine do not show correspondence.
21609320 The findings of the present study (i) indicate that GATA-4 may participate in the control of hepcidin expression, and (ii) suggest that alteration of its expression could contribute to the development of iron-related disorders.
21593278 The authors found that RNAi-mediated knockdown of the key iron modulator hepcidin increased intracellular ferritin and inhibited hepatitis C virus replication.
21535154 IL6 and hepcidin levels did not differ significantly between anaemia of unknown cause and control groups, indicating that inflammation or iron restriction is not central feature of anaemia in this group.
21518494 Hepcidin mRNA expression of Hep-3b cells can be increased by untreated multiple myeloma patient serum.
21508121 Serum hepcidin concentration may be a useful indicator of deficient iron stores.
21499082 Quantitative polymerase chain reaction showed significantly higher expression of LEAP-1 (P = 0.002) and TLR-8 (P = 0.023) and TLR-10 (P = 0.014) in viral keratitis and LEAP-2 (P = 0.034) in dry eye, versus controls.
21401300 Plasma hepcidin correlates positively with interleukin-6 in patients undergoing pulmonary endarterectomy
21346250 Hepcidin is feedback regulated by iron concentrations in plasma and the liver and by erythropoietic demand for iron
21333642 Hepcidin, by its iron regulatory action on iron metabolism may be expected to have an important role in immune regulation, inflammatory diseases and malignancies
21289291 Data indicate that hypoxia represses hepcidin expression through inhibition of BMP/SMAD4 signaling.
21285884 Serum hepcidin and prohepcidin levels are significantly altered in patients with inflammatory bowel disease as compared with levels in healthy controls, suggesting these two hormones have a substantial role of in the development of anemia.
21283681 Hepcidin is a stress-inducible peptide of the biliary epithelia and a potential marker of biliary stress
21219868 This study reveals for the first time a novel intracellular function for hepcidin other than its established cell surface action on ferroportin.
21209031 Patients with polycystic ovary syndrome had reduced serum hepcidin concentrations that might contribute to their iron overload by favoring the intestinal absorption of iron
21199652 An acute increase in hepcidin concentration reduces intestinal iron absorption through ubiquitin-dependent proteasome degradation of DMT1
21183736 Hepcidin and macrophage iron correlate with MCP-1 release and vascular damage in high-risk individuals with metabolic alterations.
21150441 Novel genetic forms of iron-related microcytic anemia have been identified, due to defects of iron transport/utilization or to TMPRSS6 deficiency and hepcidin hyperproduction.
21149632 iron itself or the kinetics of iron use in response to hypoxia may signal hepcidin down-regulation.
21145254 ex vivo whole-blood (WB) cytokine production and its association with iron status and serum hepcidin in obese versus non-obese women, was assessed.
21143959 The c.-582A > G HAMP promoter variant is not associated with serum iron, transferrin or ferritin levels in the healthy population
21143009 Hepcidin-25 is primarily an indicator for decreased body iron levels, but not for iron-restricted erythropoiesis
21126372 Hepcidin upregulated HIV-1 production in primary human mononuclear cells.
21095135 Plasma concentrations of both IL-6 and hepcidin significantly increased post-exercise following either a carbohydrate (CHO) or an isovolumetric placebo drink.
21088809 possible of HAMP mutation in porphyria cutanea tarda
21075282 Studies indicate that altered hepcidin expression is responsible for the increased iron absorption observed in beta-thalassemia.
21039223 these data indicate that HJV and HAMP functional mutations are not frequent in patients with iron overload.
21039223 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
21031015 The aqueous humor Hep level may exist locally and independent from the IL6 increase in patients with primary open-angle glaucoma.
20937842 Matriptase-2- and proprotein convertase-cleaved forms of hemojuvelin have different roles in the down-regulation of hepcidin expression
20924211 Prohepcidin serum levels were significantly elevated in chronic hepatitis C patients.
20888657 in type 2 diabetic patients serum prohepcidin was decreased
20863724 in human liver, not only HAMP, but also SMAD7 and Id1 mRNA significantly correlate with the extent of hepatic iron burden. However, this correlation is lost in patients with HFE-HC, but maintained in subjects with non-hemochromatotic iron overload.
20801192 Data show that monocyte hepcidin mRNA increased during adherence to the tissue culture wells, reaching a level 150-fold higher than baseline within 12 h of plating.
20800515 Serum hepcidin concentrations may therefore be a good predictor of AI, useful in diagnosis of anemia etiology and in treatment determination.
20721554 Data suggest that dysmetabolic hyperferritinemia is characterized by hyperferritinemia with normal transferrin saturation, elevated hepcidin levels, and mild liver iron overload in a subset of patients.
20679527 Bone morphogenetic protein 2 is a major mediator of the hepcidin stimulatory activity of multiple myeloma sera.
20660052 Testosterone administration is associated with suppression of serum hepcidin.
20655381 Findings supported the notion that under low levels of hepcidin, mutant ceruloplasmin cannot stabilize ferroportin because of a loss-of-function in the ferroxidase activity.
20653062 hepcidin may play a role in regulating iron metabolism but its synthesis is not regulated by ferritin.
20634490 transferrin receptor 2 and HFE are involved in holotransferrin-dependent signaling for the regulation of furin which involved Erk phosphorylation. Furin in turn may control hepcidin expression.
20620527 Hepcidin correlates with glomerular filtration rate and markers of iron status and inflmmation after heart transplantation.
20587610 Observational study of gene-disease association. (HuGE Navigator)
20526394 Serum concentration of prohepcidin is related to the anemia status, rather than to the current status of H. pylori infection, in iron deficiency anemia patients
20502037 [review] role of hepcidin and NGAL in iron metabolism and its regulation, particularly in kidney disease.
20299375 These findings suggest that hepcidin may mediate the negative effects of inflammation on both disordered iron metabolism and erythropoiesis in hemodialysis patients.
20191031 Data show that serum concentration of pro-hepcidin reflects disease activity in rheumatoid arthritis, regardless of anemia status.
20124516 Human mutation D157G in ferroportin leads to hepcidin-independent binding of Jak2 and ferroportin down-regulation.
20113314 hepcidin-25 can form complexes with copper, nickel and zinc
20102409 Hepcidin messenger RNA expression in human lymphocytes.
20026331 Data show that hepcidin transcription involves interactions between functional metal response elements (MREs) in its promoter, and the MRE-binding transcription factor-1.
20019408 Serum hepcidin-25 concentrations were regulated by iron storage and erythropoiesis but not by IL-6 in chronc heart failure patients with anemia
20007134 HAMP promoter mutation is associated with homozygous patients with iron overload.
19924283 Hepcidin mRNA expression in vitro is highly sensitive to the presence of serum factors and PI3 kinase inhibition and parallels TfR2 expression
19907144 Hepcidin deficiency is the cause of iron overload in hereditary hemochromatosis, iron-loading anemias, and hepatitis C. Hepcidin excess is associated with anemia of inflammation, chronic kidney disease and iron-refractory iron deficiency anemia
19890342 SGA(small for gestational age) and normal term infants had similar cord blood Hepcidin concentrations, but EPO (erythropoietin) levels were significantly higher in the SGA group
19882752 serum prohepcidin concentration is decreased in patients with polycythemia vera
19850683 increased hepcidin production, at least partly leptin mediated, represents the missing link between obesity and disrupted iron metabolism
19816411 Serum hepcidin is elevated in obese women despite iron depletion, suggesting that it is responding to inflammation rather than iron status
19787796 identified mutations in HFE, SLC40A1, HAMP, HJV, TFR2, and FTL that could explain TRANSFERRIN SATURATION/SERUM FERRITIN heterogeneity in adults with previous HFE genotyping to detect C282Y and H63D; results were correlated with racial groups
19740974 Plasma hepcidin significantly, but modestly, predicts iron bioavailability from ferrous sulfate and ferrous fumarate.
19734422 Association of hepcidin promoter c.-582 A>G variant and iron overload in thalassemia major.
19734422 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19729219 although hepcidin regulation by iron stores is maintained in chronic hepatitis C, the suppression of this hormone by hepatitis C virus is likely an important factor in liver iron accumulation in this condition
19715836 Determination of hepcidin concentrations improves the identification of iron deficiency in pretransplant patients by 21.6%.
19711434 Observational study of gene-disease association. (HuGE Navigator)
19681654 Acute inflammatory changes could affect the regulation of hepcidin expression in subcutaneous adipose tissue and thus possibly contribute to inflammation-induced systemic changes of iron metabolism during cardiac surgery.
19679815 findings show that CREBH (cyclic AMP response element-binding protein H), an endoplasmic reticulum stress-activated transcription factor, binds to and transactivates the hepcidin promoter
19656379 hepcidin-25 may have a role in metastasis of renal cell carcinoma
19652645 Cholestasis or its important component-hydrophobic bile acids-can downregulate hepcidin expression through inhibiting IL-6-induced STAT3 phosphorylation and pSTAT3 protein nuclear translocation.
19652026 Macrophage hepcidin expression is induced by the activation of STAT1 and NF-kappaB and the induction of C/EBPbeta expression.
19610021 Observational study of gene-disease association. (HuGE Navigator)
19589941 Only patient had lower hepcidin, likely reflecting the appropriate response of hepcidin to iron deficiency
19553669 Hepcidin revisited, disulfide connectivity, dynamics, and structure.
19541813 HFE mutations modulate the effect of iron on serum hepcidin-25 in chronic hemodialysis patients.
19483160 Data show that the median serum and urine hepcidin-25 levels were similar for patients and controls.
19478464 serum hepcidin-20 is transiently elevated in response to acute cardiac ischemia
19454498 Data suggest that the interleukin-1beta and bone morphogenetic protein signaling pathways are central to the regulation of HAMP expression by macrophages in this co-culture model.
19423366 a redundant system of proprotein convertases cleaves prohepcidin at the predicted site releasing active hepcidin-25 from the proprotein.
19414861 interferes with BMP-mediated hepcidin expression and may act with GDF15 to dysregulate iron homeostasis in thalassemia syndromes.
19387685 Downregulation of hepcidin is associated with hepatocellular carcinoma.
19346972 Exercise-induced inflammation, hemolysis, and hepcidin production were all evident at the conclusion of running, regardless of the surface trained upon or of the intensity trained at.
19292870 Alpha-1 antitrypsin binds preprohepcidin intracellularly and prohepcidin in the serum
19291818 Due to its crucial role in the regulation of body iron stores, hepcidin may act as a secondary risk factor in the progression of alcoholic liver disease[REVIEW].
19287179 This review discusses how iron-sensing hemojuvelin and inflammatory pathways cooperate in hepcidin gene expression through unknown mechanisms.
19254567 Because the HFE alpha3 domain interacts with receptor 2 (TfR2), these results supported the finding that TfR2/HFE complex is required for transcriptional regulation of hepcidin by holo-transferrin.
19231148 Genetic deficiency is the basis of hereditary hemochromatosis
19214511 HAMP and hemojuvelin mutations are rare among Spanish HH patients, and their impact in this population is not significant
19214511 Observational study of gene-disease association. (HuGE Navigator)
19150361 Hepcidin addition resulted in a redistribution of ferroportin to intracellular compartments that labeled with early endosomal and lysosomal, but not Golgi, markers and that trafficked along microtubules.
19099655 Hepcidin mRNA expression in HepG2 cells and human primary hepatocytes can be elevated by rhIL-6.
19093740 Prohepcidin showed itself as a negative acute phase reactant during systemic inflammatory response syndrome associated with a cardiac surgery.
19070948 The enhancement of hepcidin-25 in patients without acute kidney injury (AKI) may suggest a novel role for iron sequestration in modulating AKI.
19059216 These data suggest that beta2M is essential for the correct subcellular distribution of both HFE and hepcidin, two proteins, which are critical for iron homeostasis.
19032104 Urinary concentrations of hepcidin were strongly elevated and were associated with iron maldistribution in Plasmodium falciparum malaria.
18970934 Chromatin immunoprecipitation assay demonstrated physiologic bindings of USF2 to the hepcidin promoter in HepG2 cells. USF2 siRNA also significantly knocked down hepcidin mRNA expression.
18827264 all hemojuvelin mutants tested showed no or minimal hepcidin activation
18809758 The hepatic siderosis associated with Porphyria cutanea tarda likely results from dysregulated HAMP.
18775801 Secretion of bioactive hepcidin-25 by liver cells correlates with its gene transcription and points towards synergism between iron and inflammation signaling pathways
18762941 Observational study of gene-disease association. (HuGE Navigator)
18758412 Data suggest that in erythropoietin-resistant anemia, multiple factors, including iron and inflammation related conditions, are likely to affect the level of hepcidin and this may explain the lack of elevated serum hepcidin in this condition.
18694648 The interrelationships between sTfR1 and prohepcidin or between ferritin and hepcidin suggest that ferritin- and sTfR1-sensed hepcidin conversion system exist in human body and maybe regulated at the post-translational level.
18676162 Plasma hepcidin levels of eight patients with the anemia of ageing and sex- and age-matched controls found that the levels of hepcidin were not increased in patients with the anemia of ageing.
18671304 Hepatitis C virus-induced oxidative stress suppresses hepcidin expression through increased histone deaceetylase activity.
18641032 indicate the existence of an unknown functional erythropoiesis-associated circulating factor, other than growth differentiation factor-15, that negatively regulates hepcidin production in stem cell transplantation settings
18603562 TMPRSS6 mutation leads to overproduction of hepcidin and, in turn, to defective iron absorption and utilization
18556388 studied the link between hepcidin and anemia and inflammation in peritoneal dialysis patients
18544472 decreased EPO levels in familial amyloidosis TTR V30M correlated with the prohepcidin levels
18541040 Expression of hepcidin mRNA is strikingly suppressed in cancerous, but not in non-cancerous tissues, in patients with HCC, irrespective of ferroportin or Trf2 expression.
18495462 analysis of hepcidin, interleukin-6 and iron markers in males before and after heart surgery
18462824 Patients with dysmetabolic hepatic iron overload show appropriate regulation of mRNAs encoding proteins involved in iron uptake and efflux but dysregulation of hepcidin production
18421430 These data uncover a missing link in the HFE2-mediated control of hepcidin expression and suggest that the BMP-responsive element controls hepcidin promoter activity mediated by HFE2 and inflammatory stimuli.
18333366 Il-6 through the Jak/STAT-3 signaling pathway is involved in the regulation of hepcidin expression providing a link between inflammation and iron metabolism.
18326817 HJV-induced BMP signaling and hepcidin expression are not altered by neogenin overexpression or by inhibition of endogenous neogenin expression
18322945 Hepcidin is expressed by colorectal cancer tissue and that this may represent a novel oncogenic signalling mechanism.
18304682 hepcidin gene which plays a critical role in regulating systemic iron homeostasis.
18278547 Pro-hepcidin levels show extremely wide variations in rheumatoid arthritis and systemic lupus erythematosus.
18073346 In anemia of chronic disease, hepcidin mRNA levels were significantly correlated to serum IL-6 concentrations, and increased monocyte hepcidin mRNA levels were associated with decreased expression of iron retention.
18023212 results showed that soluble transferrin receptor (sTfR) highly associates with erythropoietic activity that strongly interfered with the iron store regulation of hepcidin; HepG2 expression results display an inverse association between hepcidin and sTfR
17962361 Suggest role for hepcidin in control of intestinal iron absorption is dependent on cell type.
17951471 Leptin upregulates hepatic hepcidin expression suggesting that leptin-induced overweign may contribute to hepcidin expression.
17905609 the hepatic prohormone convertase furin mediates the posttranslational processing of hepcidin. The proteolytic cleavage of prohepcidin to hepcidin is not regulated by iron-transferrin or the HIF pathway
17905608 HEPC MISSENSE MUTATION CAUSING INEFFICIENT CLEAVAGE INDICATES THAT THE FURIN BINDING SITE BE MORE THAN 4 RESIDUES
17847004 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17768112 hepcidin production is regulated by the combination of marrow iron requirements and iron supply by transferrin
17766053 Elevated basal hepcidin levels in the liver may inhibit the development of malaria infection.
17721544 GDF15 overexpression arising from an expanded erythroid compartment contributes to iron overload in thalassemia syndromes by inhibiting hepcidin expression.
17613866 Hypertransfusional (>8 transfusions/year) iron in liver biopsies correlated with increased expression (RNA) for iron regulatory proteins 1 and 2 (3-, 9- to 11-fold) and hepcidin RNA: (5- to 8-fold), while ferritin H and L RNA remained constant.
17577979 Studies indicate that the recombinant hepcidin secreted from P. pastoris had a molecular weight of 2.7kD.
17559363 the molecules which regulate hepcidin expression [REVIEW]
17488680 In thalassemia intermedia, high erythropoietic drive causes severe hepcidin deficiency resulting in hyperabsorption of dietary iron & macrophage iron depletion lowering ferritin secretion. In thalassemia major, transfusions reverse this.
17331161 alcohol loading down-regulates hepatic hepcidin expression and leads to the increase of iron absorption from the intestine
17229647 an additional ATG in the 5' untranslated region (UTR) of the HAMP is functional and prevents normal hepcidin production by inducing an aberrant translation initiation of the pre-hepcidin mRNA [case report]
17229646 hypoxia lowers circulating prohepcidin concentrations in humans
17112858 Elevated hepcidin values in kidney allograft recipients may be due not only to impaired renal function, but also to a low-grade inflammatory state.
16962038 Iron overload and hemochromatosis my be due to a deficiency in hepcidin.
16952548 Hepcidin is a proinflammatory adipokine and may play an important role in hypoferremia of inflammation in obese condition.
16946298 A STAT3 binding motif located at position -64/-72 of the hepcidin promoter is required for hepcidin activation in Il6-treated human liver cells.
16937259 Data show the presence of co-purified iron with 20 and 25 residue hepcidins, and present a new 3D structure that is completely different from the solved structure of the synthetic peptide.
16929540 A cross-sectional study was performed to assess hepcidin correlations with renal function, iron status, and C reactive protein in patients with chronic renal failure on conservative treatment.
16835372 Mechanism by which hepcidin can be regulated by inflammation or, in the absence of inflammatory stimuli, by alternative mechanisms leading to STAT3 activation.
16769583 central regulatory role in iron circulation and iron toxicity in patients with thalassemia.
16769573 Hepcidin is the key regulator of systemic iron homeostasis and acts by binding to the cellular iron exporter ferroportin and causing its internalization and degradation.
16737972 alcohol metabolism-mediated oxidative stress regulates hepcidin transcription via C/EBPalpha, which in turn leads to increased duodenal iron transport
16460831 The crucial role of hepcidin in the control of macrophage iron homeostasis was shown.
16315135 Hepcidin serves to decrease the export of iron from reticuloendothelial cells and absorptive enterocytes.
16204153 defective hepcidin regulation played a role in iron overload
16103673 central pathogenetic step in HFE-related hemochromatosis is impaired basal expression of HAMP rather than a lack of HAMP upregulation in response to iron stores
15998830 soluble and cell-associated hemojuvelin reciprocally regulate hepcidin expression in response to changes in extracellular iron concentration
15933050 hepcidin accumulated in the ferroportin-rich organs, liver, spleen, and proximal duodenum, highlighting the central role of the hepcidin-ferroportin interaction in iron homeostasis
15831700 the Y64N and C326Y mutants of FPN are completely resistant to hepcidin inhibition and N144D and N144H are partially resistant. Hemochromatosis-associated FPN mutations, either reduce iron export or produce an FPN variant that is insensitive to hepcidin
15797999 hepcidin levels correlated with hepatic iron stores and hemoglobin levels and may also be affected by hepatic dysfunction
15725899 REVIEW: hepcidin as the hormone that links the type II acute phase response to iron handling and erythropoiesis
15685557 Juvenile hemochromatosis is not a distinct monogenic disorder invariably due to hemojuvelin or hepcidin mutations: it may be genetically linked to the adult-onset form of hereditary hemochromatosis.
15671438 urinary hepcidin in patients with iron overload diseases
15514116 hepcidin bound to ferroportin in tissue culture cells; after binding, ferroportin was internalized and degraded, leading to decreased export of cellular iron
15198949 a mutation in HAMP may play a role in familial hemochromatosis
15178582 hepcidin has a role in inhibition of iron transport across human intestinal epithelial cells
15124018 IL-6 mediates anemia of inflammation by inducing the synthesis of HEPC.
15124013 HEPC is important in the pathogenesis of anemia of inflammation.
14670915 Observational study of gene-gene interaction. (HuGE Navigator)
14670915 Association of heterozygous mutations in the HFE and HAMP genes could lead to an adult-onset form of primary iron overload.
14630809 new mutation (C70R), which affects 1 of the 8 conserved cysteines that form the disulfide bonds and are critical for the stability of the polypeptide.
12915468 Mutations in hepcidin results in hemochromatosis
12663437 REVIEW of the role of hepcidin in iron metabolism and host defense
12637325 data suggest a close relationship between the transferrin saturation and hepatic hepcidin expression in hereditary hemochromatosis
12469120 Mutant antimicrobial peptide hepcidin is associated with severe juvenile hemochromatosis
12433676 study of molecular basis of hepcidin regulation in patients with anemia of inflammation demonstrating that HEPC is a type II acute-phase protein, is regulated by iron stores, and is a key mediator of anemia of inflammation
12393428 hepcidin plays a major, causative role in the anemia observed in a subgroup of patients with hepatic adenomas, and may be important in the pathogenesis of the anemia of chronic disease in general.
12138110 solution structures of the hepcidin-20 and -25 amino acid peptides determined by standard two-dimensional (1)H NMR spectroscopy
11836175 The sequencing of the whole hepcidin coding region, intron-exon junctions, 5' and partially 3'UTRs, did not reveal any alteration in the iron overload patients.
11034317 A highly disulfide-bonded human antimicrobial protein, LEAP1, is reported.

AA Sequence 

MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRDTHFPICIFCC      1 - 70
GCCHRSKCGMCCKT                                                             71 - 84
//

Text Mined References (338)

PMID Year Title
27129231 2016 Transforming Growth Factor ?1 (TGF-?1) Activates Hepcidin mRNA Expression in Hepatocytes.
26981017 2016 Laboratory use of hepcidin in renal transplant recipients.
26866603 2016 Circulating Hepcidin-25 Is Reduced by Endogenous Estrogen in Humans.
26807955 2016 Ceramide Induces Human Hepcidin Gene Transcription through JAK/STAT3 Pathway.
26582087 2016 Heterozygous Mutations in BMP6 Pro-peptide Lead to Inappropriate Hepcidin Synthesis and Moderate Iron Overload in Humans.
26515063 2015 Commensal Bacteria-induced Interleukin 1? (IL-1?) Secreted by Macrophages Up-regulates Hepcidin Expression in Hepatocytes by Activating the Bone Morphogenetic Protein Signaling Pathway.
26460251 2015 Erythropoietic drive is the strongest predictor of hepcidin level in adults with sickle cell disease.
26437604 2015 Ironing out Ferroportin.
26405701 2015 The Relationship of Serum Hemojuvelin and Hepcidin Levels with Iron Overload in Nonalcoholic Fatty Liver Disease.
26378394 2016 Inadequate hepcidin serum concentrations predict incident type 2 diabetes mellitus.
26310624 2015 Impaired hepcidin expression in alpha-1-antitrypsin deficiency associated with iron overload and progressive liver disease.
26304124 2015 Saturated fatty acids induce post-transcriptional regulation of HAMP mRNA via AU-rich element-binding protein, human antigen R (HuR).
26290281 2015 Elevated serum transaminase activities were associated with increased serum levels of iron regulatory hormone hepcidin and hyperferritinemia risk.
26270641 2015 Low Serum Hepcidin in Patients with Autoimmune Liver Diseases.
26252205 2015 Plasma Concentrations of Hepcidin in Anemic Zimbabwean Infants.
26244503 2015 Iron Stores, Hepcidin, and Aortic Stiffness in Individuals with Hypertension.
26164540 2015 Systemic inflammation up-regulates serum hepcidin in exacerbations and stabile chronic obstructive pulmonary disease.
26137768 2015 [SERUM HEPCIDIN LEVELS IN ENDOMETRIOSIS].
26125411 2015 Hepcidin-ferroportin axis controls toll-like receptor 4 dependent macrophage inflammatory responses in human atherosclerotic plaques.
26118202 2015 Preanalysis in Serum Hepcidin Measurement.
26055723 2015 Regulation of Iron Metabolism by Hepcidin under Conditions of Inflammation.
25976966 2015 Hepcidin and iron disorders: new biology and clinical approaches.
25976471 2015 Hereditary hemochromatosis type 1 phenotype modifiers in Italian patients. The controversial role of variants in HAMP, BMP2, FTL and SLC40A1 genes.
25923089 Correlation of hepcidin level with insulin resistance and endocrine glands function in major thalassemia.
25907691 2015 The small molecule ferristatin II induces hepatic hepcidin expression in vivo and in vitro.
25896789 2015 Expression and cellular localization of hepcidin mRNA and protein in normal rat brain.
25894587 2015 Hepcidin-25 in diabetic chronic kidney disease is predictive for mortality and progression to end stage renal disease.
25881778 2015 Hepcidin Levels Are Increased in Patients with Acute Ischemic Stroke: Preliminary Report.
25858146 2015 Hepcidin regulation in prostate and its disruption in prostate cancer.
25816754 2015 Peripheral expression of hepcidin gene in Egyptian ?-thalassemia major.
25805936 2015 Hepcidin/ferroportin expression levels involve efficacy of pegylated-interferon plus ribavirin in hepatitis C virus-infected liver.
25745821 2015 Bone marrow iron distribution, hepcidin, and ferroportin expression in renal anemia.
25742771 2015 Liver congestion in heart failure contributes to inappropriately increased serum hepcidin despite anemia.
25635054 2015 CD81 promotes both the degradation of transferrin receptor 2 (TfR2) and the Tfr2-mediated maintenance of hepcidin expression.
25633564 2015 A HAMP promoter bioassay system for identifying chemical compounds that modulate hepcidin expression.
25598191 2015 Mass spectrometry evaluation of the hepcidin-25 assay in the differential diagnosis of iron deficiency anaemia with concurrent inflammation and anaemia of inflammation in elderly patients.
25553801 2015 Association of serum hepcidin levels with the presence and severity of obstructive sleep apnea syndrome.
25519750 2015 Hepcidin is suppressed by erythropoiesis in hemoglobin E ?-thalassemia and ?-thalassemia trait.
25501198 2014 Serum hepcidin level and its clinical significance in maintenance hemodialysis patients.
25486930 2015 Hereditary hypotransferrinemia can lead to elevated transferrin saturation and, when associated to HFE or HAMP mutations, to iron overload.
25465232 2015 Serum hepcidin-25 level linked with high mortality in patients with non-Hodgkin lymphoma.
25380934 2014 Growth differentiation factor 15 is related to anemia and iron metabolism in heart allograft recipients and patients with chronic heart failure.
25363011 2015 Serum prohepcidin levels in premature newborns with oxygen radical diseases.
25222239 2014 Correlation between hepcidin level and renal anemia.
25193892 2014 Hepcidin and regulation of iron homeostasis in maintenance hemodialysis patients.
25176568 2014 Sublethal exposure of organophosphate pesticide chlorpyrifos alters cellular iron metabolism in hepatocytes and macrophages.
25134646 2014 Impact of hepcidin antimicrobial peptide on iron overload in tuberculosis patients.
25115800 2015 Hepcidin Suppresses Brain Iron Accumulation by Downregulating Iron Transport Proteins in Iron-Overloaded Rats.
25093806 2014 Disordered hepcidin-ferroportin signaling promotes breast cancer growth.
25065484 2014 Circulating factors are involved in hypoxia-induced hepcidin suppression.
25052873 2014 Hepcidin and GDF15 in anemia of multiple myeloma.
25015054 2014 The hepcidin gene promoter nc.-1010C > T; -582A > G haplotype modulates serum ferritin in individuals carrying the common H63D mutation in HFE gene.
24988613 2014 [The role of hepcidin in iron metabolism in inflammatory bowel diseases].
24954786 2015 Hepcidin in tumor-related iron deficiency anemia and tumor-related anemia of chronic disease: pathogenic mechanisms and diagnosis.
24946025 2015 Do the first, second and third trimester maternal serum hepcidin concentrations clarify obstetric complications?
24904118 2014 HFE interacts with the BMP type I receptor ALK3 to regulate hepcidin expression.
24894955 2014 Role of duodenal iron transporters and hepcidin in patients with alcoholic liver disease.
24875397 2014 Study of circulating hepcidin in association with iron excess, metabolic syndrome, and BMP-6 expression in granulosa cells in women with polycystic ovary syndrome.
24718935 2014 A complex signaling network involving protein kinase CK2 is required for hepatitis C virus core protein-mediated modulation of the iron-regulatory hepcidin gene expression.
24667393 2014 Iron status and the acute post-exercise hepcidin response in athletes.
24599423 2014 From tissue iron retention to low systemic haemoglobin levels, new pathophysiological biomarkers of human abdominal aortic aneurysm.
24596418 2014 Combinatorial effects of malaria season, iron deficiency, and inflammation determine plasma hepcidin concentration in African children.
24589273 2014 Modulation of hepcidin as therapy for primary and secondary iron overload disorders: preclinical models and approaches.
24578220 2014 A study of hepcidin and monocyte chemoattractant protein-1 in Egyptian females with systemic lupus erythematosus.
24569625 2015 Hepcidin is linked to hypoferremia in patients with rheumatic valve disease.
24533165 2014 Glial cell ceruloplasmin and hepcidin differentially regulate iron efflux from brain microvascular endothelial cells.
24520384 2014 Interleukin-10 regulates hepcidin in Plasmodium falciparum malaria.
24507043 Serum hepcidin level correlates with hyperlipidemia status in patients following allograft renal transplantation.
24478088 2014 Hepcidin induction by pathogens and pathogen-derived molecules is strongly dependent on interleukin-6.
24387766 2014 Black soyabean seed coat extract regulates iron metabolism by inhibiting the expression of hepcidin.
24356769 2013 Obesity does not influence hepcidin and hemojuvelin levels in hemodialysis patients.
24341321 2014 Does hepcidin play a role in the pathogenesis of aphthae in Behçet's disease and recurrent aphthous stomatitis?
24339866 2013 Low hepcidin levels in severely anemic malawian children with high incidence of infectious diseases and bone marrow iron deficiency.
24334869 2014 Serum hepcidin is associated with presence of plaque in postmenopausal women of a general population.
24319154 2013 Iron and hepcidin: a story of recycling and balance.
24306042 2014 Hepcidin and ferritin blood level as noninvasive tools for predicting breast cancer.
24252754 2013 The systemic iron-regulatory proteins hepcidin and ferroportin are reduced in the brain in Alzheimer's disease.
24244576 2013 Inverse relationship of serum hepcidin levels with CD4 cell counts in HIV-infected patients selected from an Indonesian prospective cohort study.
24236640 2014 The transcription factor ATOH8 is regulated by erythropoietic activity and regulates HAMP transcription and cellular pSMAD1,5,8 levels.
24204002 2014 Suppression of iron-regulatory hepcidin by vitamin D.
24179092 2013 Friend of GATA and GATA-6 modulate the transcriptional up-regulation of hepcidin in hepatocytes during inflammation.
24157792 2013 Serum-induced up-regulation of hepcidin expression involves the bone morphogenetic protein signaling pathway.
24119290 2014 Serum hepcidin levels are associated with serum triglycerides and interleukin-6 concentrations in patients with end-stage renal disease.
24014495 2013 Interleukin-1 receptor antagonist gene polymorphism and hepcidin in rheumatoid arthritis: Correlations with clinical and laboratory indices of disease activity.
23905873 2014 Hepcidin expression from monocyte of splenectomized and non-splenectomized patients with HbE-?-thalassemia.
23852902 2013 Clinical significance of serum hepcidin-25 levels in predicting invasive fungal disease in patients after transplantation.
23846698 2013 Hepcidin bound to ?2-macroglobulin reduces ferroportin-1 expression and enhances its activity at reducing serum iron levels.
23842708 2013 Serum hepcidin measured with an improved ELISA correlates with parameters of iron metabolism in patients with myelodysplastic syndrome.
23836842 2013 Novel circulating isoforms of hepcidin.
23798368 2013 Peering into the future: hepcidin testing.
23760782 2013 Serum hepcidin levels in Helicobacter pylori-infected children with iron-deficiency anemia: a case-control study.
23700338 2013 Screening identifies the Chinese medicinal plant Caulis Spatholobi as an effective HAMP expression inhibitor.
23665668 2013 Hepcidin as a predictor of disease severity in acute pancreatitis: a single center prospective study.
23656728 2013 Transfusion suppresses erythropoiesis and increases hepcidin in adult patients with ?-thalassemia major: a longitudinal study.
23647063 2014 Anemia in diffuse large B-cell non-Hodgkin lymphoma: the role of interleukin-6, hepcidin and erythropoietin.
23618075 2013 Serum hepcidin: indication of its role as an "acute phase" marker in febrile children.
23580428 2013 Hepatitis C virus core+1/ARF protein decreases hepcidin transcription through an AP1 binding site.
23536837 2013 Cellular catabolism of the iron-regulatory peptide hormone hepcidin.
23531037 2013 Tubular reabsorption and local production of urine hepcidin-25.
23460869 2013 Iron status and systemic inflammation, but not gut inflammation, strongly predict gender-specific concentrations of serum hepcidin in infants in rural Kenya.
23438894 2013 PGC-1? regulates hepatic hepcidin expression and iron homeostasis in response to inflammation.
23390933 2013 Prohepcidin binds to the HAMP promoter and autoregulates its own expression.
23390091 2013 Implication of the proprotein convertases in iron homeostasis: proprotein convertase 7 sheds human transferrin receptor 1 and furin activates hepcidin.
23380741 2013 Circulatory hepcidin is associated with the anti-inflammatory response but not with iron or anemic status in childhood malaria.
23379486 2013 Hepcidin is a potential regulator of iron status in chronic kidney disease.
23375327 Hemojuvelin and iron metabolism in kidney and heart allograft recipients.
23335357 2013 Hepcidin levels predict nonresponsiveness to oral iron therapy in patients with iron deficiency anemia.
23314535 2013 Beyond anemia: hepcidin, monocytes and inflammation.
23300182 2013 Inappropriately low hepcidin levels in patients with myelodysplastic syndrome carrying a somatic mutation of SF3B1.
23293962 2013 Hepatocyte growth factor activator inhibitor type 2 (HAI-2) modulates hepcidin expression by inhibiting the cell surface protease matriptase-2.
23179904 2012 Acidic milieu augments the expression of hepcidin, the central regulator of iron homeostasis.
23154866 2013 Molecular basis of primary iron overload in India and the role of serum-derived factors in hepcidin regulation.
23148308 2013 Serum hepcidin level is not an independent surrogate biomarker of disease activity or of radiographic progression in rheumatoid arthritis: results from the ESPOIR cohort.
23147161 2013 Hepcidin-25 is related to cardiovascular events in chronic haemodialysis patients.
23144745 2012 Increased serum hepcidin levels in subjects with the metabolic syndrome: a population study.
23110054 2012 Iron regulator hepcidin exhibits antiviral activity against hepatitis C virus.
23088733 2012 Study of serum hepcidin in hereditary hemolytic anemias.
23065513 2013 Reduced sensitivity of the ferroportin Q248H mutant to physiological concentrations of hepcidin.
23065507 2013 Plasma hepcidin levels and anemia in old age. The Leiden 85-Plus Study.
23065424 2012 Interleukin-6 and lipopolysaccharide modulate hepcidin mRNA expression by HepG2 cells.
23062413 2013 Low preoperative hepcidin concentration as a risk factor for mortality after cardiac surgery: a pilot study.
23041085 2012 Estrogen regulates iron homeostasis through governing hepatic hepcidin expression via an estrogen response element.
23012398 2013 Iron homeostasis in porphyria cutanea tarda: mutation analysis of promoter regions of CP, CYBRD1, HAMP and SLC40A1.
22951294 2012 Serum levels of the hepcidin-20 isoform in a large general population: the Val Borbera study.
22932892 2012 Sustained submicromolar H2O2 levels induce hepcidin via signal transducer and activator of transcription 3 (STAT3).
22869521 2012 The hypoxia-inducible factor-C/EBP? axis controls ethanol-mediated hepcidin repression.
22851866 2012 Analysis of hepcidin expression: in situ hybridization and quantitative polymerase chain reaction from paraffin sections.
22844726 2012 [Hepcidin and diabetic anemia: is there an association?].
22819549 2013 Glucose acts as a regulator of serum iron by increasing serum hepcidin concentrations.
22815544 2012 Intra-individual variability of serum hepcidin-25 in haemodialysis patients using mass spectrometry and ELISA.
22792339 2012 Estrogen regulates hepcidin expression via GPR30-BMP6-dependent signaling in hepatocytes.
22776295 2012 Efficient oxidative folding and site-specific labeling of human hepcidin to study its interaction with receptor ferroportin.
22768976 2012 Lower serum prohepcidin levels associated with lower iron and erythropoietin requirements in hemodialysis patients with chronic hepatitis C.
22689680 2012 Hepcidin demonstrates a biphasic association with anemia in acute Plasmodium falciparum malaria.
22682227 2012 Hepcidin-induced endocytosis of ferroportin is dependent on ferroportin ubiquitination.
22682226 2012 Molecular mechanism of hepcidin-mediated ferroportin internalization requires ferroportin lysines, not tyrosines or JAK-STAT.
22676252 2012 The serum hepcidin:ferritin ratio is a potential biomarker for cirrhosis.
22611157 2012 Induction of activin B by inflammatory stimuli up-regulates expression of the iron-regulatory peptide hepcidin through Smad1/5/8 signaling.
22609894 2012 Soluble TNF? receptor type I and hepcidin as determinants of development of anemia in the long-term follow-up of heart failure patients.
22525500 2011 [HCV NS5A protein down-regulates hepcidin gene expression and increases hepatic intracellular iron storage].
22398782 2012 Serum hemojuvelin and hepcidin levels in chronic kidney disease.
22365732 2012 Hepcidin is correlated to soluble hemojuvelin but not to increased GDF15 during pregnancy.
22306005 2012 Hepcidin and iron homeostasis.
22249207 2012 Ferroportin (SLC40A1) Q248H mutation is associated with lower circulating serum hepcidin levels in Rwandese HIV-positive women.
22248501 2012 The effects of 8 weeks of endurance running on hepcidin concentrations, inflammatory parameters, and iron status in female runners.
22228627 2012 Hepcidin is the major predictor of erythrocyte iron incorporation in anemic African children.
22227182 2012 Vitamin C affects the expression of hepcidin and erythropoietin receptor in HepG2 cells.
22125467 2011 Subcutaneous adipose tissue from obese and lean adults does not release hepcidin in vivo.
22118000 2011 Serum hepcidin in haemodialysis patients: associations with iron status and microinflammation.
22023767 Urinary hepcidin identifies a serum ferritin cut-off for iron supplementation in young athletes: a pilot study.
21971825 2011 Friend of GATA suppresses the GATA-induced transcription of hepcidin in hepatocytes through a GATA-regulatory element in the HAMP promoter.
21886780 2011 Hepcidin levels and their determinants in different types of myelodysplastic syndromes.
21885789 2011 Urinary hepcidin-25 and risk of acute kidney injury following cardiopulmonary bypass.
21882342 2011 Hepcidin and iron-mediated resistance to malaria.
21876117 2011 Chuvash polycythemia VHLR200W mutation is associated with down-regulation of hepcidin expression.
21873547 2011 TMPRSS6 rs855791 modulates hepcidin transcription in vitro and serum hepcidin levels in normal individuals.
21873546 2011 Hepcidin regulation by innate immune and infectious stimuli.
21818622 2012 Early effects of erythropoietin on serum hepcidin and serum iron bioavailability in healthy volunteers.
21810240 2011 Hepcidin expression in human airway epithelial cells is regulated by interferon-?.
21733041 2011 Serum maternal hepcidin levels 3 days after delivery are higher compared to those measured at parturition.
21654163 2011 Reproducibility of and correspondence among different hepcidin forms in blood and urine and their relationships to iron status in healthy, male Guatemalan volunteers observed over 9 weeks.
21609320 2011 GATA-4 transcription factor regulates hepatic hepcidin expression.
21593278 2011 Modulation of hepatitis C virus replication by iron and hepcidin in Huh7 hepatocytes.
21535154 2011 Erythropoietin, GDF15, IL6, hepcidin and testosterone levels in a large cohort of elderly individuals with anaemia of known and unknown cause.
21518494 2011 [Effect of recombinant human erythropoietin on hepcidin mRNA expression in patients with multiple myeloma].
21508121 2011 Serum hepcidin as a diagnostic test of iron deficiency in premenopausal female blood donors.
21499082 2011 Increased expression of hepcidin and toll-like receptors 8 and 10 in viral keratitis.
21401300 2011 Plasma hepcidin correlates positively with interleukin-6 in patients undergoing pulmonary endarterectomy.
21346250 2011 Hepcidin and iron regulation, 10 years later.
21333642 2011 Hepcidin: a novel peptide hormone regulating iron metabolism.
21289291 2011 Hypoxia inhibits hepcidin expression in HuH7 hepatoma cells via decreased SMAD4 signaling.
21285884 2011 Serum hepcidin and prohepcidin concentrations in inflammatory bowel disease.
21283681 2011 Hepcidin is an antibacterial, stress-inducible peptide of the biliary system.
21219868 2011 Transport of hepcidin, an iron-regulatory peptide hormone, into retinal pigment epithelial cells via oligopeptide transporters and its relevance to iron homeostasis.
21209031 2011 Role of decreased circulating hepcidin concentrations in the iron excess of women with the polycystic ovary syndrome.
21199652 2011 Intestinal DMT1 cotransporter is down-regulated by hepcidin via proteasome internalization and degradation.
21183736 2011 Serum hepcidin and macrophage iron correlate with MCP-1 release and vascular damage in patients with metabolic syndrome alterations.
21150441 2011 Inherited disorders of iron metabolism.
21149632 2011 Modulation of hepcidin production during hypoxia-induced erythropoiesis in humans in vivo: data from the HIGHCARE project.
21145254 2011 Suppressed cytokine production in whole blood cultures may be related to iron status and hepcidin and is partially corrected following weight reduction in morbidly obese pre-menopausal women.
21143959 2010 Genetic study of the hepcidin gene (HAMP) promoter and functional analysis of the c.-582A > G variant.
21143009 2011 Serum hepcidin-25 in comparison to biochemical markers and hematological indices for the differentiation of iron-restricted erythropoiesis.
21126372 2010 Hepcidin induces HIV-1 transcription inhibited by ferroportin.
21095135 2011 The effect of carbohydrate ingestion on plasma interleukin-6, hepcidin and iron concentrations following prolonged exercise.
21088809 2011 Hemojuvelin and hepcidin gene mutations in patients with porphyria cutanea tarda from Southern France.
21075282 2010 Anemia, ineffective erythropoiesis, and hepcidin: interacting factors in abnormal iron metabolism leading to iron overload in ?-thalassemia.
21039223 2010 Hemojuvelin and hepcidin genes sequencing in Brazilian patients with primary iron overload.
21031015 2010 Aqueous humor hepcidin prohormone levels in patients with primary open angle glaucoma.
20937842 2010 Matriptase-2- and proprotein convertase-cleaved forms of hemojuvelin have different roles in the down-regulation of hepcidin expression.
20924211 2010 Serum prohepcidin levels in chronic hepatitis C, alcoholic liver disease, and nonalcoholic fatty liver disease.
20888657 2010 Relation between serum high molecular weight adiponectin and serum ferritin or prohepcidin in patients with type 2 diabetes.
20863724 2010 Altered hepatic BMP signaling pathway in human HFE hemochromatosis.
20801192 2010 Hepcidin expression by human monocytes in response to adhesion and pro-inflammatory cytokines.
20800515 2010 Serum hepcidin but not prohepcidin may be an effective marker for anemia of inflammation (AI).
20721554 2011 Dysmetabolic hyperferritinemia is associated with normal transferrin saturation, mild hepatic iron overload, and elevated hepcidin.
20679527 2010 In anemia of multiple myeloma, hepcidin is induced by increased bone morphogenetic protein 2.
20660052 2010 Testosterone suppresses hepcidin in men: a potential mechanism for testosterone-induced erythrocytosis.
20655381 2010 Biological effects of mutant ceruloplasmin on hepcidin-mediated internalization of ferroportin.
20653062 2010 Hepcidin levels in hereditary hyperferritinemia: Insights into the iron-sensing mechanism in hepatocytes.
20634490 2010 Transferrin receptor 2 and HFE regulate furin expression via mitogen-activated protein kinase/extracellular signal-regulated kinase (MAPK/Erk) signaling. Implications for transferrin-dependent hepcidin regulation.
20620527 2010 A possible role of hepcidin in the pathogenesis of anemia in heart allograft recipients.
20587610 2010 Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
20526394 2010 Serum prohepcidin levels in Helicobacter pylori infected patients with iron deficiency anemia.
20502037 2010 Neutrophil gelatinase-associated lipocalin and hepcidin: what do they have in common and is there a potential interaction?
20299375 2010 Reduction of serum hepcidin by hemodialysis in pediatric and adult patients.
20191031 2010 Serum pro-hepcidin could reflect disease activity in patients with rheumatoid arthritis.
20124516 2010 Human mutation D157G in ferroportin leads to hepcidin-independent binding of Jak2 and ferroportin down-regulation.
20113314 2010 Characterization of the transition-metal-binding properties of hepcidin.
20102409 2010 Hepcidin messenger RNA expression in human lymphocytes.
20026331 2010 Divalent metal-dependent regulation of hepcidin expression by MTF-1.
20019408 2010 Iron regulatory hormone hepcidin decreases in chronic heart failure patients with anemia.
20007134 2010 HAMP promoter mutation nc.-153C>T in non p.C282Y homozygous patients with iron overload.
19924283 2009 Evidence for a lack of a direct transcriptional suppression of the iron regulatory peptide hepcidin by hypoxia-inducible factors.
19907144 2009 The role of hepcidin in iron metabolism.
19890342 2010 Prohepcidin concentrations and erythroid progenitors in cord blood of appropriate versus small for gestational age neonates.
19882752 2009 Decreased serum prohepcidin concentration in patients with polycythemia vera.
19850683 2009 Hepcidin in obese children as a potential mediator of the association between obesity and iron deficiency.
19816411 2010 Elevated systemic hepcidin and iron depletion in obese premenopausal females.
19787796 2009 HFE, SLC40A1, HAMP, HJV, TFR2, and FTL mutations detected by denaturing high-performance liquid chromatography after iron phenotyping and HFE C282Y and H63D genotyping in 785 HEIRS Study participants.
19740974 2009 Plasma hepcidin is a modest predictor of dietary iron bioavailability in humans, whereas oral iron loading, measured by stable-isotope appearance curves, increases plasma hepcidin.
19734422 2009 Association of hepcidin promoter c.-582 A>G variant and iron overload in thalassemia major.
19729219 2009 Reduced serum hepcidin levels in patients with chronic hepatitis C.
19715836 Hepcidin and iron deficiency in pre-kidney transplant patients.
19711434 2009 Hereditary hemochromatosis gene (HFE) variants are associated with birth weight and childhood leukemia risk.
19681654 2010 Hepcidin expression in adipose tissue increases during cardiac surgery.
19679815 2009 ER stress controls iron metabolism through induction of hepcidin.
19656379 2009 Increased serum hepcidin-25 level and increased tumor expression of hepcidin mRNA are associated with metastasis of renal cell carcinoma.
19652645 2009 Cholestasis downregulate hepcidin expression through inhibiting IL-6-induced phosphorylation of signal transducer and activator of transcription 3 signaling.
19652026 2009 Role of STAT1, NF-kappaB, and C/EBPbeta in the macrophage transcriptional regulation of hepcidin by mycobacterial infection and IFN-gamma.
19610021 2009 Mutation analysis of hepcidin and ferroportin genes in Italian prospective blood donors with iron overload.
19589941 2009 Hereditary hemochromatosis due to resistance to hepcidin: high hepcidin concentrations in a family with C326S ferroportin mutation.
19553669 2009 Hepcidin revisited, disulfide connectivity, dynamics, and structure.
19541813 2009 HFE mutations modulate the effect of iron on serum hepcidin-25 in chronic hemodialysis patients.
19483160 2009 Regulation of serum hepcidin levels in sickle cell disease.
19478464 2009 Serum hepcidin-20 is elevated during the acute phase of myocardial infarction.
19454498 2009 Activated macrophages induce hepcidin expression in HuH7 hepatoma cells.
19423366 Activation and inactivation of the iron hormone hepcidin: Biochemical characterization of prohepcidin cleavage and sequential degradation to N-terminally truncated hepcidin isoforms.
19414861 2009 Identification of TWSG1 as a second novel erythroid regulator of hepcidin expression in murine and human cells.
19387685 2009 Expression of hepcidin and other iron-regulatory genes in human hepatocellular carcinoma and its clinical implications.
19346972 2009 Training surface and intensity: inflammation, hemolysis, and hepcidin expression.
19292870 2009 Alpha-1 antitrypsin binds preprohepcidin intracellularly and prohepcidin in the serum.
19291818 2009 Is the iron regulatory hormone hepcidin a risk factor for alcoholic liver disease?
19287179 2009 Hemojuvelin: the hepcidin story continues.
19254567 2009 Interaction of the hereditary hemochromatosis protein HFE with transferrin receptor 2 is required for transferrin-induced hepcidin expression.
19252486 2009 BMP6 is a key endogenous regulator of hepcidin expression and iron metabolism.
19231148 2009 Iron in innate immunity: starve the invaders.
19214511 2009 Mutations in HAMP and HJV genes and their impact on expression of clinical hemochromatosis in a cohort of 100 Spanish patients homozygous for the C282Y mutation of HFE gene.
19150361 2009 Investigation of the biophysical and cell biological properties of ferroportin, a multipass integral membrane protein iron exporter.
19099655 2008 [Inhibition effect of rhEPO on rhIL6-induced hepcidin mRNA expression in HepG2 cell lines and human primary hepatocytes].
19093740 2009 Plasma prohepcidin as a negative acute phase reactant after large cardiac surgery with a deep hypothermic circulatory arrest.
19070948 2009 Mass spectrometry-based proteomic analysis of urine in acute kidney injury following cardiopulmonary bypass: a nested case-control study.
19059216 2009 Knockdown of beta2-microglobulin perturbs the subcellular distribution of HFE and hepcidin.
19032104 2009 Assessment of urinary concentrations of hepcidin provides novel insight into disturbances in iron homeostasis during malarial infection.
18970934 2008 Upstream stimulatory factor 2 is implicated in the progression of biliary atresia by regulation of hepcidin expression.
18827264 2008 Hemojuvelin N-terminal mutants reach the plasma membrane but do not activate the hepcidin response.
18809758 2008 Down-regulation of hepcidin in porphyria cutanea tarda.
18775801 2008 Secretion of bioactive hepcidin-25 by liver cells correlates with its gene transcription and points towards synergism between iron and inflammation signaling pathways.
18762941 2009 Non-classical hereditary hemochromatosis in Portugal: novel mutations identified in iron metabolism-related genes.
18758412 2008 Serum pro-hepcidin level and iron homeostasis in Japanese dialysis patients with erythropoietin (EPO)-resistant anemia.
18694648 Serum prohepcidin is associated with soluble transferrin receptor-1 but not ferritin in healthy post-menopausal women.
18676162 The anemia of ageing is not associated with increased plasma hepcidin levels.
18671304 2008 Hepatitis C virus-induced oxidative stress suppresses hepcidin expression through increased histone deacetylase activity.
18641032 2008 Serum hepcidin level and erythropoietic activity after hematopoietic stem cell transplantation.
18603562 2008 A mutation in the TMPRSS6 gene, encoding a transmembrane serine protease that suppresses hepcidin production, in familial iron deficiency anemia refractory to oral iron.
18556388 Hepcidin is linked to anemia and inflammation in peritoneal dialysis patients.
18544472 Low serum levels of prohepcidin, but not hepcidin-25, are related to anemia in familial amyloidosis TTR V30M.
18541040 2008 Expression of hepcidin mRNA is uniformly suppressed in hepatocellular carcinoma.
18495462 2009 Hepcidin, interleukin-6 and hematological iron markers in males before and after heart surgery.
18462824 2008 Hepcidin and iron-related gene expression in subjects with Dysmetabolic Hepatic Iron Overload.
18421430 2008 A bone morphogenetic protein (BMP)-responsive element in the hepcidin promoter controls HFE2-mediated hepatic hepcidin expression and its response to IL-6 in cultured cells.
18333366 2007 IL-6 - STAT-3 - hepcidin: linking inflammation to the iron metabolism.
18326817 2008 Hemojuvelin regulates hepcidin expression via a selective subset of BMP ligands and receptors independently of neogenin.
18322945 2008 Increased hepcidin expression in colorectal carcinogenesis.
18304682 2008 Iron and the liver: update 2008.
18278547 2008 Serum pro-hepcidin levels in rheumatoid arthritis and systemic lupus erythematosus.
18073346 2008 Autocrine formation of hepcidin induces iron retention in human monocytes.
18023212 Regulation of hepcidin: insights from biochemical analyses on human serum samples.
17962361 2008 Hepcidin inhibits apical iron uptake in intestinal cells.
17951471 2007 Leptin increases the expression of the iron regulatory hormone hepcidin in HuH7 human hepatoma cells.
17905609 Posttranslational processing of hepcidin in human hepatocytes is mediated by the prohormone convertase furin.
17905608 Commentary to: "Post-translational processing of hepcidin in human hepatocytes is mediated by the prohormone convertase furin," by Erika Valore and Tomas Ganz.
17847004 2007 Common variants in the BMP2, BMP4, and HJV genes of the hepcidin regulation pathway modulate HFE hemochromatosis penetrance.
17768112 2007 Effects of plasma transfusion on hepcidin production in human congenital hypotransferrinemia.
17766053 2008 Elevated basal hepcidin levels in the liver may inhibit the development of malaria infection: another piece towards solving the malaria puzzle?
17721544 2007 High levels of GDF15 in thalassemia suppress expression of the iron regulatory protein hepcidin.
17613866 2007 Iron homeostasis during transfusional iron overload in beta-thalassemia and sickle cell disease: changes in iron regulatory protein, hepcidin, and ferritin expression.
17577979 2007 [Cloning and secretion expression of hepcidin in Pichia pastoris].
17559363 2007 Molecular regulation of hepatic expression of iron regulatory hormone hepcidin.
17488680 2007 Liver iron concentrations and urinary hepcidin in beta-thalassemia.
17331161 2007 Hepcidin is down-regulated in alcohol loading.
17229647 2007 Molecular mechanism of hepcidin deficiency in a patient with juvenile hemochromatosis.
17229646 2007 Transient hypoxia and downregulation of circulating prohepcidin concentrations in healthy young men.
17112858 2006 Hepcidin, an acute-phase protein and a marker of inflammation in kidney transplant recipients with and without coronary artery disease.
16962038 [To prevent and cure the iron overloads, the hopes of hepcidin].
16952548 2006 Increased adipose tissue expression of hepcidin in severe obesity is independent from diabetes and NASH.
16946298 2007 STAT3 mediates hepatic hepcidin expression and its inflammatory stimulation.
16937259 2006 Modelling of a metal-containing hepcidin.
16929540 2006 Hepcidin, iron status, and renal function in chronic renal failure, kidney transplantation, and hemodialysis.
16835372 2006 Interleukin-6 induces hepcidin expression through STAT3.
16769583 2006 The effects of erythropoetic activity and iron burden on hepcidin expression in patients with thalassemia major.
16769573 2006 Hepcidin and iron-loading anemias.
16737972 2006 Alcohol metabolism-mediated oxidative stress down-regulates hepcidin transcription and leads to increased duodenal iron transporter expression.
16460831 2006 Hepcidin generated by hepatoma cells inhibits iron export from co-cultured THP1 monocytes.
16315135 2005 Pathophysiology of hereditary hemochromatosis.
16204153 2005 A Portuguese patient homozygous for the -25G>A mutation of the HAMP promoter shows evidence of steady-state transcription but fails to up-regulate hepcidin levels by iron.
16103673 2005 Iron stores modulate hepatic hepcidin expression by an HFE-independent pathway.
15998830 2005 Competitive regulation of hepcidin mRNA by soluble and cell-associated hemojuvelin.
15933050 2005 Synthetic hepcidin causes rapid dose-dependent hypoferremia and is concentrated in ferroportin-containing organs.
15831700 2005 Resistance to hepcidin is conferred by hemochromatosis-associated mutations of ferroportin.
15797999 2005 Hepcidin levels in humans are correlated with hepatic iron stores, hemoglobin levels, and hepatic function.
15725899 2005 Anemia of inflammation: the hepcidin link.
15685557 2005 Juvenile hemochromatosis associated with pathogenic mutations of adult hemochromatosis genes.
15671438 2005 Hepcidin in iron overload disorders.
15514116 2004 Hepcidin regulates cellular iron efflux by binding to ferroportin and inducing its internalization.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15198949 2004 Severe hemochromatosis in a Portuguese family associated with a new mutation in the 5'-UTR of the HAMP gene.
15178582 2004 Inhibition of iron transport across human intestinal epithelial cells by hepcidin.
15124018 2004 IL-6 mediates hypoferremia of inflammation by inducing the synthesis of the iron regulatory hormone hepcidin.
15124013 2004 Anemia of inflammation: the cytokine-hepcidin link.
15099344 2004 A homozygous HAMP mutation in a multiply consanguineous family with pseudo-dominant juvenile hemochromatosis.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14670915 2004 HAMP as a modifier gene that increases the phenotypic expression of the HFE pC282Y homozygous genotype.
14633868 2003 Identification of new mutations of the HFE, hepcidin, and transferrin receptor 2 genes by denaturing HPLC analysis of individuals with biochemical indications of iron overload.
14630809 2004 Screening hepcidin for mutations in juvenile hemochromatosis: identification of a new mutation (C70R).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12915468 2003 Digenic inheritance of mutations in HAMP and HFE results in different types of haemochromatosis.
12663437 2003 Hepcidin, a key regulator of iron metabolism and mediator of anemia of inflammation.
12637325 2003 Expression of hepcidin in hereditary hemochromatosis: evidence for a regulation in response to the serum transferrin saturation and to non-transferrin-bound iron.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12469120 2003 Mutant antimicrobial peptide hepcidin is associated with severe juvenile hemochromatosis.
12433676 2003 Hepcidin, a putative mediator of anemia of inflammation, is a type II acute-phase protein.
12393428 2002 Inappropriate expression of hepcidin is associated with iron refractory anemia: implications for the anemia of chronic disease.
12138110 2002 The solution structure of human hepcidin, a peptide hormone with antimicrobial activity that is involved in iron uptake and hereditary hemochromatosis.
12010514 2002 Chemical synthesis of beta-defensins and LEAP-1/hepcidin.
11113132 2001 A new mouse liver-specific gene, encoding a protein homologous to human antimicrobial peptide hepcidin, is overexpressed during iron overload.
11113131 2001 Hepcidin, a urinary antimicrobial peptide synthesized in the liver.
11034317 2000 LEAP-1, a novel highly disulfide-bonded human peptide, exhibits antimicrobial activity.