Property Summary

NCBI Gene PubMed Count 37
PubMed Score 296.38
PubTator Score 91.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Hyperinsulinemic hypoglycemia 17 4.399 2.2

Expression

  Differential Expression (15)

Disease log2 FC p
active ulcerative colitis -1.020 2.4e-02
acute myeloid leukemia -1.100 9.2e-03
acute quadriplegic myopathy -1.001 2.6e-05
astrocytoma 1.200 3.3e-02
colon cancer -1.200 1.0e-02
ductal carcinoma in situ -1.400 1.1e-03
interstitial cystitis -1.100 1.7e-03
invasive ductal carcinoma -1.400 3.4e-03
lung adenocarcinoma 1.067 6.9e-03
Multiple myeloma 1.230 1.9e-03
ovarian cancer -1.200 7.2e-04
pancreatic ductal adenocarcinoma liver m... -1.194 2.0e-03
posterior fossa group B ependymoma 1.200 1.5e-09
sonic hedgehog group medulloblastoma 1.200 4.8e-07
Waldenstrons macroglobulinemia 1.206 3.1e-02

Gene RIF (18)

AA Sequence

MAFVTRQFMRSVSSSSTASASAKKIIVKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGI      1 - 70
EESLRKVAKKKFAENLKAGDEFVEKTLSTIATSTDAASVVHSTDLVVEAIVENLKVKNELFKRLDKFAAE     71 - 140
HTIFASNTSSLQITSIANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLVDFSKALGKHPVS    141 - 210
CKDTPGFIVNRLLVPYLMEAIRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEM    211 - 280
DAENPLHQPSPSLNKLVAENKFGKKTGEGFYKYK                                        281 - 314
//

Text Mined References (41)

PMID Year Title