Property Summary

NCBI Gene PubMed Count 19
PubMed Score 72.49
PubTator Score 13.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
urothelial carcinoma -1.100 2.3e-02
psoriasis -1.700 1.1e-04
osteosarcoma 3.746 6.6e-07
autosomal dominant Emery-Dreifuss muscul... 1.081 2.4e-03
juvenile dermatomyositis 1.371 2.7e-11
acute quadriplegic myopathy 1.506 2.8e-06
non-small cell lung cancer 1.231 4.1e-12
intraductal papillary-mucinous adenoma (... 1.500 2.3e-03
intraductal papillary-mucinous neoplasm ... 1.300 3.4e-02
lung cancer 1.700 1.1e-03
interstitial cystitis -1.600 6.2e-04
aldosterone-producing adenoma -1.335 4.2e-02
lung adenocarcinoma 1.394 4.9e-07
lung carcinoma 1.800 2.8e-28
breast carcinoma 1.100 3.4e-13
Pick disease -1.200 4.2e-03
ductal carcinoma in situ 1.400 4.1e-03
invasive ductal carcinoma 2.000 5.0e-03
ovarian cancer 2.900 8.2e-05
Down syndrome 1.600 6.3e-04
pancreatic cancer 1.100 4.5e-02

Gene RIF (7)

PMID Text
25687571 Our results indicate that PTPLAD1 (HACD3) is in complex with insulin receptor (IR) in rat's liver and in human HEK293 cells. SiRNA-mediated partial knockdown of PTPLAD1 increased level of IR tyrosine phosphorylation and affect IR endocytosis. PTPLAD1 depletion strongly enhanced insulin effect on Glut2 translocation in HEK293 cells similar to the increase in AKT-ser473 phosphorylation. [PTPLAD1]
23125841 Tandem affinity purification and mass spectrometry analysis identify protein tyrosine phosphatase-like A domain containing 1 (PTPLAD1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22560525 Genes in the erythroid differentiation and cell cycle regulation pathways influence interindividual variation in RBC indices. Our results provide insights into the molecular basis underlying variation in RBC traits.
22190034 Tandem affinity purification and mass spectrometry analysis identify protein tyrosine phosphatase-like A domain containing 1 (PTPLAD1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
19656872 These results suggest that an Hsp90-dependent chaperone pathway incorporating hB-ind1 is involved in protein folding in the membranous web for the circumvention of the UPR and that it facilitates HCV replication
18160438 results suggest that hB-ind1 plays a crucial role in HCV RNA replication and the propagation of JFH1 virus through interaction with viral and host proteins
16516406 The structure of the B-IND1 gene promoter region was determined.

AA Sequence

MENQVLTPHVYWAQRHRELYLRVELSDVQNPAISITENVLHFKAQGHGAKGDNVYEFHLEFLDLVKPEPV      1 - 70
YKLTQRQVNITVQKKVSQWWERLTKQEKRPLFLAPDFDRWLDESDAEMELRAKEEERLNKLRLESEGSPE     71 - 140
TLTNLRKGYLFMYNLVQFLGFSWIFVNLTVRFCILGKESFYDTFHTVADMMYFCQMLAVVETINAAIGVT    141 - 210
TSPVLPSLIQLLGRNFILFIIFGTMEEMQNKAVVFFVFYLWSAIEIFRYSFYMLTCIDMDWKVLTWLRYT    211 - 280
LWIPLYPLGCLAEAVSVIQSIPIFNETGRFSFTLPYPVKIKVRFSFFLQIYLIMIFLGLYINFRHLYKQR    281 - 350
RRRYGQKKKKIH                                                              351 - 362
//

Text Mined References (35)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25687571 2015 The last enzyme of the de novo purine synthesis pathway 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase (ATIC) plays a central role in insulin signaling and the Golgi/endosomes protein network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23935497 2013 Rab18 binds to hepatitis C virus NS5A and promotes interaction between sites of viral replication and lipid droplets.
23222517 2012 Seventy-five genetic loci influencing the human red blood cell.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22560525 2012 Genetic Loci implicated in erythroid differentiation and cell cycle regulation are associated with red blood cell traits.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19656872 2009 Cochaperone activity of human butyrate-induced transcript 1 facilitates hepatitis C virus replication through an Hsp90-dependent pathway.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18554506 2008 Characterization of four mammalian 3-hydroxyacyl-CoA dehydratases involved in very long-chain fatty acid synthesis.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18160438 2008 Human butyrate-induced transcript 1 interacts with hepatitis C virus NS5A and regulates viral replication.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16638134 2006 SSeCKS/Gravin/AKAP12 attenuates expression of proliferative and angiogenic genes during suppression of v-Src-induced oncogenesis.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16516406 2006 Human B-ind1 gene promoter: cloning and regulation by histone deacetylase inhibitors.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
10747961 2000 B-ind1, a novel mediator of Rac1 signaling cloned from sodium butyrate-treated fibroblasts.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.