Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.96
PubTator Score 1.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Multiple myeloma 1.394 2.0e-02
osteosarcoma 3.648 5.0e-09
atypical teratoid / rhabdoid tumor -1.300 3.2e-04
medulloblastoma -1.300 4.5e-04
medulloblastoma, large-cell -1.900 2.2e-07
autosomal dominant Emery-Dreifuss muscul... 1.697 1.2e-03
acute quadriplegic myopathy 1.178 8.5e-07
intraductal papillary-mucinous neoplasm ... 1.300 1.3e-02
Breast cancer 2.500 2.6e-02
adult high grade glioma -1.200 8.3e-05
subependymal giant cell astrocytoma -1.282 3.6e-02
ductal carcinoma in situ -1.100 1.2e-02
ovarian cancer 1.600 1.4e-03
dermatomyositis 1.100 2.9e-02

Gene RIF (3)

PMID Text
20677014 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
15024066 Data describe a novel human member of the protein tyrosine phosphatase-like B (PTPLB) family, an integral protein of the endoplasmic reticulum membrane, as a BAP31-interacting protein.

AA Sequence

MAAVAATAAAKGNGGGGGRAGAGDASGTRKKKGPGPLATAYLVIYNVVMTAGWLVIAVGLVRAYLAKGSY      1 - 70
HSLYYSIEKPLKFFQTGALLEILHCAIGIVPSSVVLTSFQVMSRVFLIWAVTHSVKEVQSEDSVLLFVIA     71 - 140
WTITEIIRYSFYTFSLLNHLPYLIKWARYTLFIVLYPMGVSGELLTIYAALPFVRQAGLYSISLPNKYNF    141 - 210
SFDYYAFLILIMISYIPIFPQLYFHMIHQRRKILSHTEEHKKFE                              211 - 254
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18554506 2008 Characterization of four mammalian 3-hydroxyacyl-CoA dehydratases involved in very long-chain fatty acid synthesis.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15024066 2004 The yeast split-ubiquitin membrane protein two-hybrid screen identifies BAP31 as a regulator of the turnover of endoplasmic reticulum-associated protein tyrosine phosphatase-like B.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.