Property Summary

NCBI Gene PubMed Count 21
PubMed Score 10.42
PubTator Score 10.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -1.600 1.9e-03
ependymoma -1.800 3.5e-03
oligodendroglioma -1.600 8.1e-03
psoriasis -1.500 1.8e-02
glioblastoma -1.900 4.4e-05
group 4 medulloblastoma -2.000 1.7e-08
atypical teratoid / rhabdoid tumor -1.900 1.5e-08
medulloblastoma, large-cell -2.600 1.3e-06
primitive neuroectodermal tumor -1.500 2.5e-04
tuberculosis -1.100 2.6e-05
lung cancer 1.800 1.6e-04
breast carcinoma -1.300 3.6e-04
pediatric high grade glioma -1.700 9.5e-07
pilocytic astrocytoma -1.100 1.5e-06
subependymal giant cell astrocytoma -1.518 3.4e-02
invasive ductal carcinoma -1.200 4.3e-03

Gene RIF (9)

PMID Text
21771594 Ki-1/57 may be involved in translational regulation
20551049 Observational study of gene-disease association. (HuGE Navigator)
20436279 Ki-1/57 is localized to several subnuclear domains, all of which have been described to splicing and other RNA processing events.
19523114 Findings suggest that Ki-1/57 is probably involved in cellular events related to RNA functions, such as pre-mRNA splicing.
18788774 Data suggest that Ki-1/57 has characteristics of an intrinsically unstructured protein, which may explain its functional plasticity.
16879614 Has two conserved Gly/Arg-rich motif clusters (RGG/RXR box, where X is any amino acid) that may be substrates for arginine-methylation by PRMT1.
15862299 MEF2C DNA-binding activity is inhibited through its interaction with Ki-1/57.
14699138 association of Ki-1/57 with the RACK1/PKC pathway and may be important for the regulation of its cellular functions
12505151 interacts with the C-terminal region of the human chromatin-remodeling factor CHD-3

AA Sequence

MKGALGSPVAAAGAAMQESFGCVVANRFHQLLDDESDPFDILREAERRRQQQLQRKRRDEAAAAAGAGPR      1 - 70
GGRSPAGASGHRAGAGGRRESQKERKSLPAPVAQRPDSPGGGLQAPGQKRTPRRGEQQGWNDSRGPEGML     71 - 140
ERAERRSYREYRPYETERQADFTAEKFPDEKPGDRFDRDRPLRGRGGPRGGMRGRGRGGPGNRVFDAFDQ    141 - 210
RGKREFERYGGNDKIAVRTEDNMGGCGVRTWGSGKDTSDVEPTAPMEEPTVVEESQGTPEEESPAKVPEL    211 - 280
EVEEETQVQEMTLDEWKNLQEQTRPKPEFNIRKPESTVPSKAVVIHKSKYRDDMVKDDYEDDSHVFRKPA    281 - 350
NDITSQLEINFGNLPRPGRGARGGTRGGRGRIRRAENYGPRAEVVMQDVAPNPDDPEDFPALS           351 - 413
//

Text Mined References (27)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21771594 2011 Evidence for the association of the human regulatory protein Ki-1/57 with the translational machinery.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20551049 2010 Confirmation of linkage to and localization of familial colon cancer risk haplotype on chromosome 9q22.
20436279 From protein interaction profile to functional assignment: the human protein Ki-1/57 is associated with pre-mRNA splicing events.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19523114 2009 Functional association of human Ki-1/57 with pre-mRNA splicing events.
18788774 2008 Human regulatory protein Ki-1/57 has characteristics of an intrinsically unstructured protein.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16879614 2006 Ki-1/57 interacts with PRMT1 and is a substrate for arginine methylation.
16455055 2006 Evidence for the interaction of the regulatory protein Ki-1/57 with p53 and its interacting proteins.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15862299 2005 MEF2C DNA-binding activity is inhibited through its interaction with the regulatory protein Ki-1/57.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14699138 2004 Ki-1/57 interacts with RACK1 and is a substrate for the phosphorylation by phorbol 12-myristate 13-acetate-activated protein kinase C.
14630798 2004 Characterization of the proteins released from activated platelets leads to localization of novel platelet proteins in human atherosclerotic lesions.
12505151 2003 Characterization of a new family of proteins that interact with the C-terminal region of the chromatin-remodeling factor CHD-3.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10887182 2000 Molecular characterization of a novel intracellular hyaluronan-binding protein.
9523163 1997 Characterization, mapping and partial cDNA sequence of the 57-kD intracellular Ki-1 antigen.
6457647 1981 Characterization of the proteins of isolated human platelet alpha-granules. Evidence for a separate alpha-granule-pool of the glycoproteins IIb and IIIa.
1310832 1992 Cellular localizations and processing of the two molecular forms of the Hodgkin-associated Ki-1 (CD30) antigen. The protein kinase Ki-1/57 occurs in the nucleus.